Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55885
Gene name Gene Name - the full gene name approved by the HGNC.	LIM domain only 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LMO3
Synonyms (NCBI Gene) Gene synonyms aliases	RBTN3, RBTNL2, RHOM3, Rhom-3
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p12.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the rhombotin family of cysteine-rich LIM domain oncogenes. This gene is predominantly expressed in the brain. Related family members, LMO1 and LMO2 on chromosome 11, have been reported to be involved in chromos

Show/Hide all(60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017853	hsa-miR-335-5p	Microarray	18185580
MIRT1111879	hsa-miR-1226	CLIP-seq
MIRT1111880	hsa-miR-1236	CLIP-seq
MIRT1111881	hsa-miR-1305	CLIP-seq
MIRT1111882	hsa-miR-141	CLIP-seq
MIRT1111883	hsa-miR-200a	CLIP-seq
MIRT1111884	hsa-miR-219-5p	CLIP-seq
MIRT1111885	hsa-miR-27a	CLIP-seq
MIRT1111886	hsa-miR-27b	CLIP-seq
MIRT1111887	hsa-miR-28-3p	CLIP-seq
MIRT1111888	hsa-miR-3140-3p	CLIP-seq
MIRT1111889	hsa-miR-338-3p	CLIP-seq
MIRT1111890	hsa-miR-3674	CLIP-seq
MIRT1111891	hsa-miR-375	CLIP-seq
MIRT1111892	hsa-miR-4310	CLIP-seq
MIRT1111893	hsa-miR-4422	CLIP-seq
MIRT1111894	hsa-miR-4445	CLIP-seq
MIRT1111895	hsa-miR-4659a-3p	CLIP-seq
MIRT1111896	hsa-miR-4659b-3p	CLIP-seq
MIRT1111897	hsa-miR-4699-5p	CLIP-seq
MIRT1111898	hsa-miR-4753-3p	CLIP-seq
MIRT1111899	hsa-miR-4768-5p	CLIP-seq
MIRT1111900	hsa-miR-4777-5p	CLIP-seq
MIRT1111901	hsa-miR-4778-3p	CLIP-seq
MIRT1111902	hsa-miR-4782-3p	CLIP-seq
MIRT1111903	hsa-miR-508-3p	CLIP-seq
MIRT1111904	hsa-miR-5096	CLIP-seq
MIRT1111905	hsa-miR-513a-5p	CLIP-seq
MIRT1111906	hsa-miR-518d-5p	CLIP-seq
MIRT1111907	hsa-miR-519b-5p	CLIP-seq
MIRT1111908	hsa-miR-519c-5p	CLIP-seq
MIRT1111909	hsa-miR-520c-5p	CLIP-seq
MIRT1111910	hsa-miR-526a	CLIP-seq
MIRT1111911	hsa-miR-548aa	CLIP-seq
MIRT1111912	hsa-miR-548p	CLIP-seq
MIRT1111913	hsa-miR-634	CLIP-seq
MIRT1111914	hsa-miR-4712-3p	CLIP-seq
MIRT1920589	hsa-miR-205	CLIP-seq
MIRT1920590	hsa-miR-2682	CLIP-seq
MIRT1920591	hsa-miR-449c	CLIP-seq
MIRT1920592	hsa-miR-940	CLIP-seq
MIRT1920589	hsa-miR-205	CLIP-seq
MIRT1920590	hsa-miR-2682	CLIP-seq
MIRT1920591	hsa-miR-449c	CLIP-seq
MIRT1920592	hsa-miR-940	CLIP-seq
MIRT2031232	hsa-miR-3143	CLIP-seq
MIRT2031233	hsa-miR-3607-3p	CLIP-seq
MIRT2031234	hsa-miR-3686	CLIP-seq
MIRT2031235	hsa-miR-4775	CLIP-seq
MIRT2031236	hsa-miR-543	CLIP-seq
MIRT2031237	hsa-miR-590-3p	CLIP-seq
MIRT2262026	hsa-miR-3145-3p	CLIP-seq
MIRT1111903	hsa-miR-508-3p	CLIP-seq
MIRT2465552	hsa-miR-2113	CLIP-seq
MIRT2465553	hsa-miR-218	CLIP-seq
MIRT2465554	hsa-miR-338-5p	CLIP-seq
MIRT2465555	hsa-miR-3671	CLIP-seq
MIRT2465556	hsa-miR-3977	CLIP-seq
MIRT2465557	hsa-miR-607	CLIP-seq
MIRT2465558	hsa-miR-636	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
NKX2-1	Unknown	23322301

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 31515488
GO:0005737	Component	Cytoplasm	IDA	23823477
GO:0035360	Process	Positive regulation of peroxisome proliferator activated receptor signaling pathway	IDA	23823477
GO:0045600	Process	Positive regulation of fat cell differentiation	IMP	23823477
GO:0046872	Function	Metal ion binding	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	23823477
GO:2000324	Process	Positive regulation of glucocorticoid receptor signaling pathway	IDA	23823477

MIM	HGNC	e!Ensembl
180386	6643	ENSG00000048540

Protein

UniProt ID

Q8TAP4

Protein name

LIM domain only protein 3 (LMO-3) (Neuronal-specific transcription factor DAT1) (Rhombotin-3)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	13 → 71	LIM domain	Domain
PF00412	LIM	77 → 134	LIM domain	Domain

Sequence

MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANL
ILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFL
KNNMILCQTDYEEGLMKEGYAPQVR

Sequence length

145

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Tourette syndrome	Gilles de la Tourette syndrome	rs193302861, rs191284403, rs267606861	30818990

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Diabetes	Diabetes	GWAS
Tourette Syndrome	Tourette Syndrome	GWAS
Insomnia	Insomnia	GWAS

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	35854639
Adenocarcinoma of Lung	Associate	23322301
Adenoma Oxyphilic	Associate	28986304
Carcinogenesis	Associate	33980985
Carcinoma Basal Cell	Inhibit	38366633
Carcinoma Hepatocellular	Associate	30219064
Carcinoma Pancreatic Ductal	Associate	38366633
Carcinoma Squamous Cell	Associate	22011669
Carcinoma Squamous Cell	Inhibit	38366633
Endometrial Neoplasms	Associate	36581816
Glioma	Associate	25829251
Lymphoma Large B Cell Diffuse	Associate	27184832
Meningioma	Associate	23840654
Metabolic Diseases	Associate	23840654
Neoplasm Metastasis	Associate	30219064
Neoplasms	Associate	25829251, 35854639
Neoplasms	Inhibit	35445910
Neoplasms Squamous Cell	Inhibit	38366633
Neuroblastoma	Associate	21573214, 36037157
Pancreatic Neoplasms	Associate	38366633
Parathyroid Diseases	Associate	28986304
Personality Disorders	Associate	23840654
Polyposis Syndrome Hereditary Mixed 1	Associate	35854639
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	32142900
Stomach Neoplasms	Stimulate	29436606
Thyroid Carcinoma Anaplastic	Associate	27796151

LMO3 (LIM domain only 3)