Gene Gene information from NCBI Gene database.
Entrez ID 5588
Gene name Protein kinase C theta
Gene symbol PRKCQ
Synonyms (NCBI Gene)
PRKCTnPKC-theta
Chromosome 10
Chromosome location 10p15.1
Summary Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs2236379 G>A,C Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
12
miRTarBase ID miRNA Experiments Reference
MIRT1263387 hsa-miR-3659 CLIP-seq
MIRT1263388 hsa-miR-4658 CLIP-seq
MIRT1263389 hsa-miR-4758-5p CLIP-seq
MIRT1263390 hsa-miR-574-5p CLIP-seq
MIRT1263391 hsa-miR-622 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
RUNX1 Unknown 21252065
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
60
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001558 Process Regulation of cell growth NAS 8444877
GO:0001772 Component Immunological synapse IEA
GO:0002376 Process Immune system process IEA
GO:0004672 Function Protein kinase activity IDA 34593629
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600448 9410 ENSG00000065675
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q04759
Protein name Protein kinase C theta type (EC 2.7.11.13) (nPKC-theta)
Protein function Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that mediates non-redundant functions in T-cell receptor (TCR) signaling, including T-cells activation, proliferation, differentiation and surv
PDB 1XJD , 2ENJ , 2ENN , 2ENZ , 2JED , 4Q9Z , 4RA5 , 5F9E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00130 C1_1 160 212 Phorbol esters/diacylglycerol binding domain (C1 domain) Domain
PF00130 C1_1 232 284 Phorbol esters/diacylglycerol binding domain (C1 domain) Domain
PF00069 Pkinase 380 634 Protein kinase domain Domain
PF00433 Pkinase_C 655 696 Protein kinase C terminal domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in skeletal muscle, T-cells, megakaryoblastic cells and platelets. {ECO:0000269|PubMed:7686153}.
Sequence
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGS
AINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGIN
QKLMAEALAMIESTQQ
ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLP
EPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLF
REINWEELERKEIDPPFRPKVKSPFD
CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSF
MNPGMERLIS
Sequence length 706
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  NF-kappa B signaling pathway
Autophagy - animal
Vascular smooth muscle contraction
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Inflammatory mediator regulation of TRP channels
Adipocytokine signaling pathway
Insulin resistance
Shigellosis
PD-L1 expression and PD-1 checkpoint pathway in cancer
  Apoptotic cleavage of cellular proteins
Effects of PIP2 hydrolysis
Downstream TCR signaling
FCERI mediated NF-kB activation
Netrin-1 signaling
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Inflammatory bowel disease 1 Conflicting classifications of pathogenicity rs2236379 RCV001784354
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 33863396
Adenocarcinoma of Lung Associate 35029906
Alopecia Associate 31908401
Angioedema Inhibit 23838604
Angioedema Associate 23838604, 32080354
Arthritis Juvenile Associate 19674979, 28990043
Arthritis Rheumatoid Associate 19503088
Asthma Associate 34741802
Autoimmune Diseases Associate 26784953, 31908401
Breast Neoplasms Associate 24319668, 24891615, 40597019