GSDMB (gasdermin B)

Gene

• Entrez ID: 55876
• Gene name: Gasdermin B
• Gene symbol: GSDMB
• Synonyms (NCBI Gene): GSDMB-1, GSDML, PP4052, PRO2521
• Chromosome: 17
• Chromosome location: 17q21.1
• Summary: This gene encodes a member of the gasdermin-domain containing protein family. Other gasdermin-family genes are implicated in the regulation of apoptosis in epithelial cells, and are linked to cancer. Alternative splicing and the use of alternative promote

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017179	hsa-miR-335-5p	Microarray	18185580
MIRT529037	hsa-miR-5692a	PAR-CLIP	21572407
MIRT529037	hsa-miR-5692a	PAR-CLIP	22012620
MIRT735131	hsa-miR-15a-5p	Microarray, qRT-PCR	33291534
MIRT529037	hsa-miR-5692a	PAR-CLIP	21572407
MIRT529037	hsa-miR-5692a	PAR-CLIP	22012620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0005543	Function	Phospholipid binding	IDA	28154144
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA	28154144, 32299851, 36157507, 36899106
GO:0005886	Component	Plasma membrane	IEA
GO:0012501	Process	Programmed cell death	IEA
GO:0016020	Component	Membrane	IEA
GO:0022829	Function	Wide pore channel activity	IDA	32299851, 34022140, 36599845, 36899106, 36991122, 36991125
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0042742	Process	Defense response to bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	34022140
GO:0051873	Process	Killing by host of symbiont cells	IDA	34022140
GO:0055085	Process	Transmembrane transport	IEA
GO:0070269	Process	Pyroptotic inflammatory response	IBA
GO:0070269	Process	Pyroptotic inflammatory response	IDA	36899106, 36991122, 36991125
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32299851, 36157507, 36899106, 36991122, 36991125
GO:0070273	Function	Phosphatidylinositol-4-phosphate binding	IBA
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IDA	32299851, 36157507
GO:1901612	Function	Cardiolipin binding	IDA	34022140
GO:1902483	Process	Cytotoxic T cell pyroptotic cell death	IDA	32299851
GO:1902483	Process	Cytotoxic T cell pyroptotic cell death	IDA	28154144, 32299851, 34022140, 36599845, 36991122, 36991125

Other IDs

• MIM: 611221
• HGNC: 23690
• e!Ensembl: ENSG00000073605

Protein

• UniProt ID: Q8TAX9
• Protein name: Gasdermin-B (Gasdermin-like protein) [Cleaved into: Gasdermin-B, N-terminal (GSDMB-NT) (p30); Gasdermin-B, C-terminal (GSDMB-CT) (p16)]
• Protein function: [Gasdermin-B]: Precursor of a pore-forming protein that acts as a downstream mediator of granzyme-mediated cell death (PubMed:32299851). This form constitutes the precursor of the pore-forming protein: upon cleavage, the released N-terminal moie
• PDB: 5TIB, 5TJ2, 5TJ4, 7WJQ, 8EFP, 8ET1, 8ET2, 8GTJ, 8GTK, 8GTN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04598	Gasdermin	4 → 237	Gasdermin pore forming domain	Domain
  PF17708	Gasdermin_C	243 → 382	Gasdermin PUB domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: In the gastrointestinal tract, expressed in proliferating cells, including in the basal cell layer of esophagus and in isthmus/neck of stomach. {ECO:0000269|PubMed:19051310}.
• Sequence:

  MFSVFEEITRIVVKEMDAGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCRHYTTGLTLMD
  ILDTDGDKWLDELDSGLQGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKI
  SENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWS
  QISQGHLSYKHKGQREVTIPPNRVLSYRVKQLVFPNKETMSAGLDIHFRGKTKSFPEGKS
  LGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGE
  LHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKD
  QVKSVMEQNWDELASSPPDMDYDPEARILCALYVVVSILLELAEGPTSVSS

• Sequence length: 411