Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55872
Gene name Gene Name - the full gene name approved by the HGNC.	PDZ binding kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PBK
Synonyms (NCBI Gene) Gene synonyms aliases	CT84, HEL164, Nori-3, SPK, TOPK
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p21.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be invo

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004449	hsa-miR-373-3p	Microarray	15685193
MIRT004449	hsa-miR-373-3p	Microarray	15685193
MIRT695240	hsa-miR-449b-3p	HITS-CLIP	23313552
MIRT695239	hsa-miR-4699-3p	HITS-CLIP	23313552
MIRT695238	hsa-miR-216b-3p	HITS-CLIP	23313552
MIRT695240	hsa-miR-449b-3p	HITS-CLIP	23313552
MIRT695239	hsa-miR-4699-3p	HITS-CLIP	23313552
MIRT695238	hsa-miR-216b-3p	HITS-CLIP	23313552
MIRT1215592	hsa-miR-1183	CLIP-seq
MIRT1215593	hsa-miR-224	CLIP-seq
MIRT1215594	hsa-miR-3130-5p	CLIP-seq
MIRT1215595	hsa-miR-3653	CLIP-seq
MIRT1215596	hsa-miR-3658	CLIP-seq
MIRT1215597	hsa-miR-3668	CLIP-seq
MIRT1215598	hsa-miR-3924	CLIP-seq
MIRT1215599	hsa-miR-3973	CLIP-seq
MIRT1215600	hsa-miR-4255	CLIP-seq
MIRT1215601	hsa-miR-4263	CLIP-seq
MIRT1215602	hsa-miR-4310	CLIP-seq
MIRT1215603	hsa-miR-4468	CLIP-seq
MIRT1215604	hsa-miR-4482	CLIP-seq
MIRT1215605	hsa-miR-4799-5p	CLIP-seq
MIRT1215606	hsa-miR-520d-5p	CLIP-seq
MIRT1215607	hsa-miR-520g	CLIP-seq
MIRT1215608	hsa-miR-520h	CLIP-seq
MIRT1215609	hsa-miR-524-5p	CLIP-seq
MIRT1215610	hsa-miR-548a-3p	CLIP-seq
MIRT1215611	hsa-miR-548a-5p	CLIP-seq
MIRT1215612	hsa-miR-548ab	CLIP-seq
MIRT1215613	hsa-miR-548ak	CLIP-seq
MIRT1215614	hsa-miR-548b-5p	CLIP-seq
MIRT1215615	hsa-miR-548c-5p	CLIP-seq
MIRT1215616	hsa-miR-548d-5p	CLIP-seq
MIRT1215617	hsa-miR-548e	CLIP-seq
MIRT1215618	hsa-miR-548f	CLIP-seq
MIRT1215619	hsa-miR-548h	CLIP-seq
MIRT1215620	hsa-miR-548i	CLIP-seq
MIRT1215621	hsa-miR-548j	CLIP-seq
MIRT1215622	hsa-miR-548k	CLIP-seq
MIRT1215623	hsa-miR-548n	CLIP-seq
MIRT1215624	hsa-miR-548t	CLIP-seq
MIRT1215625	hsa-miR-548w	CLIP-seq
MIRT1215626	hsa-miR-548y	CLIP-seq
MIRT1215627	hsa-miR-559	CLIP-seq
MIRT1215628	hsa-miR-576-5p	CLIP-seq
MIRT2062037	hsa-miR-1207-3p	CLIP-seq
MIRT2062038	hsa-miR-590-3p	CLIP-seq
MIRT2062037	hsa-miR-1207-3p	CLIP-seq
MIRT2290561	hsa-miR-1273f	CLIP-seq
MIRT2290562	hsa-miR-143	CLIP-seq
MIRT2290563	hsa-miR-145	CLIP-seq
MIRT2290564	hsa-miR-3161	CLIP-seq
MIRT2290565	hsa-miR-409-3p	CLIP-seq
MIRT1215600	hsa-miR-4255	CLIP-seq
MIRT2290566	hsa-miR-4276	CLIP-seq
MIRT2290567	hsa-miR-4302	CLIP-seq
MIRT2290568	hsa-miR-4708-5p	CLIP-seq
MIRT2290569	hsa-miR-4770	CLIP-seq
MIRT2290570	hsa-miR-4793-5p	CLIP-seq
MIRT2290571	hsa-miR-545	CLIP-seq
MIRT1215611	hsa-miR-548a-5p	CLIP-seq
MIRT1215612	hsa-miR-548ab	CLIP-seq
MIRT1215613	hsa-miR-548ak	CLIP-seq
MIRT1215614	hsa-miR-548b-5p	CLIP-seq
MIRT1215615	hsa-miR-548c-5p	CLIP-seq
MIRT1215616	hsa-miR-548d-5p	CLIP-seq
MIRT1215619	hsa-miR-548h	CLIP-seq
MIRT1215620	hsa-miR-548i	CLIP-seq
MIRT1215621	hsa-miR-548j	CLIP-seq
MIRT1215623	hsa-miR-548n	CLIP-seq
MIRT2290572	hsa-miR-548p	CLIP-seq
MIRT1215624	hsa-miR-548t	CLIP-seq
MIRT1215625	hsa-miR-548w	CLIP-seq
MIRT1215626	hsa-miR-548y	CLIP-seq
MIRT1215627	hsa-miR-559	CLIP-seq
MIRT2290573	hsa-miR-579	CLIP-seq
MIRT2290574	hsa-miR-582-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ATM	Unknown	15220931

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	NAS	10779557
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	10779557
GO:0004708	Function	MAP kinase kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	10779557, 12620389, 17482142, 20622899, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	25575812
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	IEA
GO:0034644	Process	Cellular response to UV	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0051403	Process	Stress-activated MAPK cascade	IBA
GO:0051403	Process	Stress-activated MAPK cascade	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
611210	18282	ENSG00000168078

Protein

UniProt ID

Q96KB5

Protein name

Lymphokine-activated killer T-cell-originated protein kinase (EC 2.7.12.2) (Cancer/testis antigen 84) (CT84) (MAPKK-like protein kinase) (Nori-3) (PDZ-binding kinase) (Spermatogenesis-related protein kinase) (SPK) (T-LAK cell-originated protein kinase)

Protein function

Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint durin

PDB

5J0A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	33 → 318	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules. {ECO:0000269|PubMed:10781613, ECO:0000269|PubMed:11378444}.

Sequence

MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGE
KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEM
MTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVC
TNEDPKDRPSAAHIVEALETDV

Sequence length

322

Interactions

View interactions

PBK (PDZ binding kinase)