Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55867
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 22 member 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC22A11
Synonyms (NCBI Gene) Gene synonyms aliases	OAT4, hOAT4
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placent

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments
MIRT1354297	hsa-miR-1207-5p	CLIP-seq
MIRT1354298	hsa-miR-1321	CLIP-seq
MIRT1354299	hsa-miR-22	CLIP-seq
MIRT1354300	hsa-miR-3153	CLIP-seq
MIRT1354301	hsa-miR-3160-3p	CLIP-seq
MIRT1354302	hsa-miR-3190	CLIP-seq
MIRT1354303	hsa-miR-4487	CLIP-seq
MIRT1354304	hsa-miR-4728-5p	CLIP-seq
MIRT1354305	hsa-miR-4736	CLIP-seq
MIRT1354306	hsa-miR-4739	CLIP-seq
MIRT1354307	hsa-miR-4756-5p	CLIP-seq
MIRT1354308	hsa-miR-4763-3p	CLIP-seq
MIRT1354309	hsa-miR-558	CLIP-seq
MIRT1354310	hsa-miR-671-5p	CLIP-seq
MIRT2104819	hsa-miR-1254	CLIP-seq
MIRT2104820	hsa-miR-3116	CLIP-seq
MIRT2104821	hsa-miR-661	CLIP-seq
MIRT2329437	hsa-miR-922	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005452	Function	Solute:inorganic anion antiporter activity	IDA	15037815
GO:0005515	Function	Protein binding	IPI	16236806
GO:0005886	Component	Plasma membrane	IDA	10660625
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11907186, 15102942, 15291761, 18501590
GO:0009897	Component	External side of plasma membrane	IDA	15102942
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015297	Function	Antiporter activity	IEA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IDA	10660625
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	TAS
GO:0015698	Process	Inorganic anion transport	IEA
GO:0015711	Process	Organic anion transport	IBA
GO:0015711	Process	Organic anion transport	IDA	10660625, 15291761
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	15037815
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0046415	Process	Urate metabolic process	IMP	19503597
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
607097	18120	ENSG00000168065

Protein

UniProt ID

Q9NSA0

Protein name

Solute carrier family 22 member 11 (Organic anion transporter 4) (OAT4) (Organic anion:dicarboxylate exchanger OAT4)

Protein function

Antiporter that mediates the transport of conjugated steroids and other specific organic anions at the basal membrane of syncytiotrophoblast and at the apical membrane of proximal tubule epithelial cells, in exchange for anionic compounds (PubMe

PDB

8WJH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	103 → 526	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in placental trophoblasts, syncytiotrophoblast and cytotrophoblast (PubMed:10660625, PubMed:12409283, PubMed:26277985). Also located in the proximal tubules in kidneys (PubMed:10660625, PubMed:15037815, PubMed:26277985). {ECO

Sequence

MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCWTHMLDNGSAV
STNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYD
RSVFTSTIVAKWDLVCSSQGLKPLSQSIFMSGILVGSFIWGLLSYRFGRKPMLSWCCLQL
AVAGTSTIFAPTFVIYCGLRFVAAFGMAGIFLSSLTLMVEWTTTSRRAVTMTVVGCAFSA
GQAALGGLAFALRDWRTLQLAASVPFFAISLISWWLPESARWLIIKGKPDQALQELRKVA
RINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAMLVVNFSLLISY
YGLVFDLQSLGRDIFLLQALFGAVDFLGRATTALLLSFLGRRTIQAGSQAMAGLAILANM
LVPQDLQTLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILHTVGRLGAMMGP
LILMSRQALPLLPPLLYGVISIASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQ
EAVTVESTSL

Sequence length

550

Interactions

View interactions

	Reactome
			Organic anion transport

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Gout	Gout	N/A	N/A	GWAS
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Inhibit	40023574
Glycosuria Renal	Associate	24025986
Gout	Associate	24025986, 24360580, 26290326, 38222853
Hyperuricemia	Associate	38222853
Lupus Erythematosus Systemic	Inhibit	40023574
Non alcoholic Fatty Liver Disease	Associate	36328481

SLC22A11 (solute carrier family 22 member 11)