Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55858
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 165
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM165
Synonyms (NCBI Gene) Gene synonyms aliases
CDG2K, FT27, GDT1, SLC64A1, TMPT27, TPARL
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a predicted transmembrane protein with a perinuclear Golgi-like distribution in fibroblasts. Mutations in this gene are associated with the autosomal recessive disorder congenital disorder of glycosylation, type IIk. Knockdown of this ge
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs387907221 G>A Pathogenic Coding sequence variant, missense variant, non coding transcript variant
rs793888506 G>A Pathogenic Intron variant
rs886037631 G>A Pathogenic Coding sequence variant, intron variant, non coding transcript variant, missense variant
rs1560383746 C>T Likely-pathogenic 5 prime UTR variant, stop gained, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028789 hsa-miR-26b-5p Microarray 19088304
MIRT052436 hsa-let-7a-5p CLASH 23622248
MIRT051768 hsa-let-7c-5p CLASH 23622248
MIRT050801 hsa-miR-17-5p CLASH 23622248
MIRT039158 hsa-miR-769-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005384 Function Manganese ion transmembrane transporter activity IBA
GO:0005765 Component Lysosomal membrane IDA 23575229
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA 22683087
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614726 30760 ENSG00000134851
Protein
UniProt ID Q9HC07
Protein name Putative divalent cation/proton antiporter TMEM165 (Transmembrane protein 165) (Transmembrane protein PT27) (Transmembrane protein TPARL)
Protein function Putative divalent cation:proton antiporter that exchanges calcium or manganese ions for protons across the Golgi membrane. Mediates the reversible transport of calcium or manganese to the Golgi lumen driven by the proton gradient and possibly th
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01169 UPF0016 98 171 Uncharacterized protein family UPF0016 Family
PF01169 UPF0016 238 312 Uncharacterized protein family UPF0016 Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:22683087}.
Sequence
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAV
QGPEPARVEKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIM
AMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFG
IRMLREGLK
MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQA
LTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTV
TIIGGIVFLAFA
FSALFISPDSGF
Sequence length 324
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
congenital disorder of glycosylation Congenital disorder of glycosylation N/A N/A ClinVar
Coronary artery disease Coronary artery disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Attention Deficit Disorder with Hyperactivity Associate 30696097
Bipolar Disorder Associate 18228528
Carcinoma Hepatocellular Stimulate 30015898
Congenital disorder of glycosylation type II Associate 22683087, 30307768
Congenital Disorders of Glycosylation Associate 22683087, 27008884, 28323990, 30015898, 31415112
Congenital Hereditary and Neonatal Diseases and Abnormalities Associate 31351090
Endocrine System Diseases Associate 28323990
Immunologic Deficiency Syndromes Inhibit 22683087
Metabolic Diseases Associate 30015898
Neoplasm Invasiveness Associate 30015898