PKN1 (protein kinase N1)

Gene

• Entrez ID: 5585
• Gene name: Protein kinase N1
• Gene symbol: PKN1
• Synonyms (NCBI Gene): DBK, PAK-1, PAK1, PKN, PKN-ALPHA, PRK1, PRKCL1
• Chromosome: 19
• Chromosome location: 19p13.12
• Summary: The protein encoded by this gene belongs to the protein kinase C superfamily. This kinase is activated by Rho family of small G proteins and may mediate the Rho-dependent signaling pathway. This kinase can be activated by phospholipids and by limited prot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029573	hsa-miR-26b-5p	Microarray	19088304
MIRT049164	hsa-miR-92a-3p	CLASH	23622248
MIRT042418	hsa-miR-425-3p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001782	Process	B cell homeostasis	IEA
GO:0001783	Process	B cell apoptotic process	IEA
GO:0002634	Process	Regulation of germinal center formation	IEA
GO:0002637	Process	Regulation of immunoglobulin production	IEA
GO:0003014	Process	Renal system process	IEA
GO:0003682	Function	Chromatin binding	IDA	18066052
GO:0004672	Function	Protein kinase activity	TAS	8135837, 10792047
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	18066052
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	20188095
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004698	Function	Calcium-dependent protein kinase C activity	IEA
GO:0005080	Function	Protein kinase C binding	IPI	20228790
GO:0005515	Function	Protein binding	IPI	12761180, 16189514, 16331689, 16611232, 20188095, 21516116, 25416956, 25513777, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	12514133
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	12514133, 17332740
GO:0005768	Component	Endosome	IDA	9478917
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	12514133
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	18066052
GO:0006468	Process	Protein phosphorylation	IDA	17332740
GO:0006469	Process	Negative regulation of protein kinase activity	IEA
GO:0006972	Process	Hyperosmotic response	IEA
GO:0007165	Process	Signal transduction	TAS	8135837
GO:0007257	Process	Activation of JUN kinase activity	TAS
GO:0010631	Process	Epithelial cell migration	IMP	21754995
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0030374	Function	Nuclear receptor coactivator activity	IDA	12514133
GO:0030374	Function	Nuclear receptor coactivator activity	IMP	18066052
GO:0030496	Component	Midbody	IDA	17332740
GO:0030889	Process	Negative regulation of B cell proliferation	IEA
GO:0031267	Function	Small GTPase binding	IDA	9478917, 10619026, 18006505
GO:0032154	Component	Cleavage furrow	IDA	17332740
GO:0032991	Component	Protein-containing complex	IEA
GO:0035402	Function	Histone kinase activity (H3-T11 specific)	IDA	18066052
GO:0035407	Process	Histone H3-T11 phosphorylation	IDA	18066052
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0042393	Function	Histone binding	IDA	18066052
GO:0042826	Function	Histone deacetylase binding	IDA	20188095
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0048536	Process	Spleen development	IEA
GO:0050681	Function	Androgen receptor binding	IDA	12514133, 18066052
GO:2000145	Process	Regulation of cell motility	IMP	21754995

Other IDs

• MIM: 601032
• HGNC: 9405
• e!Ensembl: ENSG00000123143

Protein

• UniProt ID: Q16512
• Protein name: Serine/threonine-protein kinase N1 (EC 2.7.11.13) (Protease-activated kinase 1) (PAK-1) (Protein kinase C-like 1) (Protein kinase C-like PKN) (Protein kinase PKN-alpha) (Protein-kinase C-related kinase 1) (Serine-threonine protein kinase N)
• Protein function: PKC-related serine/threonine-protein kinase involved in various processes such as regulation of the intermediate filaments of the actin cytoskeleton, cell migration, tumor cell invasion and transcription regulation. Part of a signaling cascade t
• PDB: 1CXZ, 1URF, 2RMK, 4NKG, 4OTD, 4OTG, 4OTH, 4OTI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02185	HR1	38 → 102	Hr1 repeat	Family
  PF02185	HR1	127 → 196	Hr1 repeat	Family
  PF02185	HR1	214 → 281	Hr1 repeat	Family
  PF00069	Pkinase	615 → 874	Protein kinase domain	Domain
  PF00433	Pkinase_C	895 → 937	Protein kinase C terminal domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Found ubiquitously. Expressed in heart, brain, placenta, lung, skeletal muscle, kidney and pancreas. Expressed in numerous tumor cell lines, especially in breast tumor cells. {ECO:0000269|PubMed:21754995}.
• Sequence:

  MASDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLR
  RATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHVVLPDPAATHDGPQSPGAGGPTC
  SATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDII
  RMQLRRALQAGQLENQAAPDDTQGSPDLGAVELRIEELRHHFRVEHAVAEGAKNVLRLLS
  AAKAPDRKAVSEAQEKLTESNQKLGLLREALERRLGELPADHPKGRLLREELAAASSAAF
  STRLAGPFPATHYSTLCKPAPLTGTLEVRVVGCRDLPETIPWNPTPSMGGPGTPDSRPPF
  LSRPARGLYSRSGSLSGRSSLKAEAENTSEVSTVLKLDNTVVGQTSWKPCGPNAWDQSFT
  LELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFRNPV
  IERIPRLRRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATGTGTFSPGASPGS
  EARTTGDISVEKLNLGTDSDSSPQKSSRDPPSSPSSLSSPIQESTAPELPSETQETPGPA
  LCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESL
  MCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFY
  SACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPE
  FLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSA
  EAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTD
  VSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFLDFDFVAGGC

• Sequence length: 942

Pathways

KEGG:

PI3K-Akt signaling pathway
NOD-like receptor signaling pathway
Salmonella infection
Yersinia infection

Reactome:

RHO GTPases activate PKNs
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Colorectal cancer	Adenocarcinoma of large intestine	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800, rs63750198, rs63751109, rs863223312, rs63750710, rs63751615, rs63750206, rs63750781, rs63750899, rs63750691, rs63750217, rs121912965, rs63749939, rs63751194, rs63750693, rs63750540, rs63751221, rs193922370, rs80359596, rs397514632, rs483352909, rs200495564, rs397514684, rs397516436, rs398122386, rs79512956, rs74953290, rs587779001, rs63750677, rs63749837, rs267607816, rs63751715, rs267607819, rs267607815, rs267607822, rs63749906, rs587778883, rs63750472, rs63751012, rs63750715, rs63750580, rs267607706, rs267607709, rs267607710, rs587778894, rs63750749, rs63750483, rs63751015, rs63751153, rs63751094, rs63751118, rs63750316, rs63749981, rs587778906, rs267607821, rs587778908, rs63750020, rs587778909, rs63750713, rs267607825, rs63751592, rs281864936, rs587778913, rs587778914, rs63749795, rs63750855, rs63749916, rs63749923, rs63751472, rs63751689, rs267607832, rs267607837, rs267607836, rs587778923, rs63750028, rs587778928, rs587778929, rs587778930, rs63751277, rs587778933, rs267607842, rs267607843, rs63750192, rs587778934, rs63750193, rs587778937, rs587778938, rs267607845, rs63751244, rs63751393, rs63751460, rs267607849, rs267607853, rs267607856, rs267607850, rs63751657, rs267607854, rs267607852, rs587778942, rs63750309, rs63750587, rs63749863, rs63751486, rs63750016, rs63749868, rs63750375, rs63750035, rs63750604, rs63750386, rs63750150, rs63750486, rs63751428, rs267607866, rs63749986, rs63751594, rs63750152, rs63750850, rs267607867, rs267607868, rs63751632, rs267607871, rs63751892, rs587778956, rs63750469, rs587778958, rs63749792, rs267607875, rs63751255, rs281864938, rs63751202, rs63750726, rs63751310, rs63749900, rs587778964, rs267607879, rs267607878, rs587778966, rs267607883, rs267607887, rs63750061, rs63750663, rs587778968, rs587778971, rs63750809, rs63749867, rs63750864, rs587778972, rs63751275, rs267607718, rs267607722, rs63750769, rs267607717, rs587778973, rs267607716, rs267607720, rs63749995, rs63750859, rs587778975, rs63750114, rs587778976, rs63750603, rs267607889, rs267607723, rs63750561, rs63750499, rs63751642, rs63751022, rs587778981, rs63750971, rs267607898, rs267607906, rs267607903, rs587778989, rs587778992, rs267607894, rs267607901, rs267607892, rs63750437, rs587778997, rs587778998, rs63750005, rs63750641, rs63751421, rs11541859, rs63750266, rs111052004, rs267607726, rs267607727, rs63750453, rs267607734, rs267607735, rs63751665, rs267607736, rs267607732, rs63749816, rs63750539, rs267607739, rs587779006, rs587779008, rs267607745, rs267607742, rs63751595, rs267607743, rs587779010, rs587779012, rs63750057, rs63749818, rs63751124, rs587779014, rs587779015, rs63749820, rs63751302, rs267607750, rs267607751, rs267607749, rs63750891, rs63749959, rs63749804, rs267607765, rs267607760, rs587779021, rs267607759, rs63750515, rs587779023, rs63751021, rs63751480, rs267607772, rs267607773, rs587779024, rs63751653, rs587779027, rs267607767, rs587779029, rs63750706, rs63750385, rs267607774, rs267607778, rs267607780, rs587779034, rs63751711, rs267607784, rs587779035, rs63750823, rs63750822, rs267607787, rs63750303, rs63749839, rs63749827, rs267607789, rs267607790, rs267607791, rs267607786, rs267607771, rs267607795, rs267607794, rs267607788, rs267607799, rs267607801, rs587779045, rs63750034, rs587779047, rs63750216, rs63751707, rs63751598, rs267607803, rs267607777, rs63750144, rs267607805, rs63750547, rs63750489, rs63750993, rs587779054, rs63751259, rs63749926, rs63750796, rs587779058, rs63750745, rs63750582, rs180177084, rs587779866, rs200389141, rs587779950, rs587780104, rs587780183, rs587778536, rs587780683, rs587781554, rs267607712, rs587777627, rs587783057, rs730881734, rs41542214, rs730881273, rs786203456, rs786201990, rs786202767, rs748005072, rs786204317, rs786204318, rs797045117, rs63750549, rs863225383, rs863225384, rs863225373, rs863225376, rs863225377, rs863225378, rs863225379, rs863225380, rs863225381, rs63750059, rs267607823, rs864622457, rs869312767, rs869312753, rs876661059, rs876658915, rs876658923, rs876660860, rs876660822, rs876660458, rs876660214, rs876658657, rs876658247, rs876659226, rs876658821, rs876660589, rs876659068, rs876659681, rs876659608, rs878853794, rs878853778, rs878853780, rs878853785, rs886039423, rs886039424, rs1057517543, rs1057517541, rs756843954, rs1057517617, rs1057517558, rs1057519256, rs1060500689, rs764085979, rs1060500707, rs1060500699, rs1060500706, rs1060500703, rs1064795341, rs1064793607, rs1064794348, rs1064795441, rs1064794373, rs1064793172, rs1064794122, rs1064795515, rs1064794331, rs63750978, rs1114167435, rs1553641362, rs63751448, rs1553648029, rs1553648058, rs587778903, rs1553653237, rs1553664353, rs267607744, rs1553647995, rs1553648047, rs1553653084, rs1553663750, rs1553664436, rs1553488015, rs1553637293, rs63750310, rs63750443, rs63751596, rs1553646681, rs550890395, rs1064796057, rs1553642079, rs1553648023, rs587782087, rs746536721, rs1553653037, rs1248251121, rs1553646602, rs1434898623, rs1553665683, rs1553648068, rs1553645331, rs1553644123, rs1553658246, rs1553651299, rs1553648149, rs1553663159, rs1302248679, rs1553664119, rs1553658009, rs1553665977, rs1416171624, rs1553663834, rs1553664617, rs1553664702, rs1553647969, rs1553648040, rs1437454428, rs1553641273, rs63751101, rs1553646764, rs1553648225, rs1554082118, rs1553648201, rs1553638868, rs1553665866, rs376736188, rs1553642707, rs1553645226, rs1553652883, rs63751435, rs1553653115, rs1553653195, rs63750300, rs1553662622, rs1553658104, rs1553648220, rs1559544064, rs63750584, rs267608083, rs1559551570, rs1559575107, rs1559553501, rs1565986506, rs1559524405, rs1559553492, rs1559554339, rs1559588540, rs1559558071, rs761329565, rs1559521039, rs1559574795, rs1567221417, rs1559578422, rs1481129490, rs1570714352, rs779783209, rs1575376830, rs1575469070, rs1575537843, rs1575620443, rs1575621506, rs587779022, rs1575414904, rs1575449093, rs1575469505, rs1575536254, rs1575537933, rs1575632112, rs1575639851, rs1575441094, rs1575449402, rs267607831, rs2081922847, rs2083403132, rs2085415927, rs2085469647, rs2043913790, rs147542208

Unknown
Disease term	Disease name	Evidence	References	Source
Urolithiasis	Urolithiasis			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Arthritis Gouty	Associate	39511617
Calcinosis Cutis	Stimulate	35533253
Carcinoma Endometrioid	Associate	19427017
Carcinoma Pancreatic Ductal	Associate	30206226
Endometrial Neoplasms	Associate	23839494, 35533253
Fatigue Syndrome Chronic	Associate	16049284
Glioblastoma	Associate	37480215
Glioma	Associate	37480215
Heart Diseases	Associate	35748249
Hyperkinesis	Associate	20648052
Inflammatory Bowel Diseases	Associate	32764209
Intellectual Disability	Associate	20648052
Melanoma	Associate	24114839
Mesothelioma	Associate	19427017
Neoplasm Metastasis	Associate	37387515
Neoplasms	Associate	19427017, 21357687, 23839494, 26296974, 31045890, 35533253, 35745070, 37387515, 37480215
Neoplasms Cystic Mucinous and Serous	Associate	19427017
Ovarian Neoplasms	Associate	19427017
Pancreatic Neoplasms	Associate	30206226, 31059194
Prostatic Neoplasms	Associate	12514133, 19427017, 21357687, 26296974, 27268279
Prostatitis	Associate	21357687
Rectal Diseases	Associate	37387515
Rhabdomyosarcoma	Associate	25768946
Secretory breast carcinoma	Associate	31045890