Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55848
Gene name	Plasminogen receptor with a C-terminal lysine
Gene symbol	PLGRKT
Synonyms (NCBI Gene)	AD025C9orf46MDS030PLG-RKTPlg-R(KT)
Chromosome	9
Chromosome location	9p24.1

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023956	hsa-miR-1-3p	Proteomics	18668040
MIRT029997	hsa-miR-26b-5p	Microarray	19088304
MIRT532464	hsa-miR-513b-3p	PAR-CLIP	22012620
MIRT532463	hsa-miR-105-5p	PAR-CLIP	22012620
MIRT532462	hsa-miR-7853-5p	PAR-CLIP	22012620
MIRT532461	hsa-miR-1306-5p	PAR-CLIP	22012620
MIRT532460	hsa-miR-584-3p	PAR-CLIP	22012620
MIRT532459	hsa-miR-4277	PAR-CLIP	22012620
MIRT532458	hsa-miR-6872-3p	PAR-CLIP	22012620
MIRT532457	hsa-miR-4797-3p	PAR-CLIP	22012620
MIRT532456	hsa-miR-4264	PAR-CLIP	22012620
MIRT532455	hsa-miR-6879-3p	PAR-CLIP	22012620
MIRT532454	hsa-miR-3671	PAR-CLIP	22012620
MIRT532453	hsa-miR-4659a-5p	PAR-CLIP	22012620
MIRT532452	hsa-miR-4659b-5p	PAR-CLIP	22012620
MIRT532451	hsa-miR-607	PAR-CLIP	22012620
MIRT532450	hsa-miR-4255	PAR-CLIP	22012620
MIRT532449	hsa-miR-4712-5p	PAR-CLIP	22012620
MIRT532448	hsa-miR-770-5p	PAR-CLIP	22012620
MIRT532447	hsa-miR-199a-5p	PAR-CLIP	22012620
MIRT532446	hsa-miR-199b-5p	PAR-CLIP	22012620
MIRT532445	hsa-miR-4778-3p	PAR-CLIP	22012620
MIRT532443	hsa-miR-4326	PAR-CLIP	22012620
MIRT532444	hsa-miR-3682-5p	PAR-CLIP	22012620
MIRT532442	hsa-miR-4691-5p	PAR-CLIP	22012620
MIRT532441	hsa-miR-6792-3p	PAR-CLIP	22012620
MIRT532440	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT532439	hsa-miR-4659a-3p	PAR-CLIP	22012620
MIRT532438	hsa-miR-4659b-3p	PAR-CLIP	22012620
MIRT532464	hsa-miR-513b-3p	PAR-CLIP	22012620
MIRT532463	hsa-miR-105-5p	PAR-CLIP	22012620
MIRT532462	hsa-miR-7853-5p	PAR-CLIP	22012620
MIRT532461	hsa-miR-1306-5p	PAR-CLIP	22012620
MIRT532460	hsa-miR-584-3p	PAR-CLIP	22012620
MIRT532459	hsa-miR-4277	PAR-CLIP	22012620
MIRT532458	hsa-miR-6872-3p	PAR-CLIP	22012620
MIRT532457	hsa-miR-4797-3p	PAR-CLIP	22012620
MIRT532456	hsa-miR-4264	PAR-CLIP	22012620
MIRT532455	hsa-miR-6879-3p	PAR-CLIP	22012620
MIRT532454	hsa-miR-3671	PAR-CLIP	22012620
MIRT532453	hsa-miR-4659a-5p	PAR-CLIP	22012620
MIRT532452	hsa-miR-4659b-5p	PAR-CLIP	22012620
MIRT532451	hsa-miR-607	PAR-CLIP	22012620
MIRT532450	hsa-miR-4255	PAR-CLIP	22012620
MIRT532449	hsa-miR-4712-5p	PAR-CLIP	22012620
MIRT532448	hsa-miR-770-5p	PAR-CLIP	22012620
MIRT532447	hsa-miR-199a-5p	PAR-CLIP	22012620
MIRT532446	hsa-miR-199b-5p	PAR-CLIP	22012620
MIRT532445	hsa-miR-4778-3p	PAR-CLIP	22012620
MIRT532443	hsa-miR-4326	PAR-CLIP	22012620
MIRT532444	hsa-miR-3682-5p	PAR-CLIP	22012620
MIRT532442	hsa-miR-4691-5p	PAR-CLIP	22012620
MIRT532441	hsa-miR-6792-3p	PAR-CLIP	22012620
MIRT532440	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT532439	hsa-miR-4659a-3p	PAR-CLIP	22012620
MIRT532438	hsa-miR-4659b-3p	PAR-CLIP	22012620

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005886	Component	Plasma membrane	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0010756	Process	Positive regulation of plasminogen activation	IBA
GO:0010756	Process	Positive regulation of plasminogen activation	IEA
GO:0010756	Process	Positive regulation of plasminogen activation	IEA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
618444	23633	ENSG00000107020

Q9HBL7

Protein name

Plasminogen receptor (KT) (Plg-R(KT))

Protein function

Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10166	DUF2368	1 → 134	Uncharacterised conserved protein (DUF2368)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in peripheral blood cells and monocytes. Expressed in adrenal medulla. {ECO:0000269|PubMed:21795689, ECO:0000269|PubMed:21940822}.

Sequence

MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTF
FGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSK
LQLPRGMITFESIEKARKEQSRFFIDK

Sequence length

147

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	28990359	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	35454092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	17391312	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	35454092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sexual Infantilism	Associate	28990359	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	17391312, 35398964	★★★★★ ★☆☆☆☆ Found in Text Mining only

PLGRKT (plasminogen receptor with a C-terminal lysine)