Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55844
Gene name	Protein phosphatase 2 regulatory subunit Bdelta
Gene symbol	PPP2R2D
Synonyms (NCBI Gene)	B55DB55deltaMDS026
Chromosome	10
Chromosome location	10q26.3

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026700	hsa-miR-192-5p	Microarray	19074876
MIRT737125	hsa-miR-1275	qRT-PCR	33910530
MIRT1257613	hsa-miR-1228	CLIP-seq
MIRT1257614	hsa-miR-1262	CLIP-seq
MIRT1257615	hsa-miR-3151	CLIP-seq
MIRT1257616	hsa-miR-3179	CLIP-seq
MIRT1257617	hsa-miR-339-3p	CLIP-seq
MIRT1257618	hsa-miR-342-3p	CLIP-seq
MIRT1257619	hsa-miR-3936	CLIP-seq
MIRT1257620	hsa-miR-3978	CLIP-seq
MIRT1257621	hsa-miR-423-3p	CLIP-seq
MIRT1257622	hsa-miR-4303	CLIP-seq
MIRT1257623	hsa-miR-4461	CLIP-seq
MIRT1257624	hsa-miR-4476	CLIP-seq
MIRT1257625	hsa-miR-4481	CLIP-seq
MIRT1257626	hsa-miR-4682	CLIP-seq
MIRT1257627	hsa-miR-4701-3p	CLIP-seq
MIRT1257628	hsa-miR-4729	CLIP-seq
MIRT1257629	hsa-miR-4745-5p	CLIP-seq
MIRT1257630	hsa-miR-4758-5p	CLIP-seq
MIRT1257631	hsa-miR-4778-5p	CLIP-seq
MIRT1257632	hsa-miR-4796-5p	CLIP-seq
MIRT1257633	hsa-miR-596	CLIP-seq
MIRT1257634	hsa-miR-601	CLIP-seq
MIRT1920797	hsa-miR-1914	CLIP-seq
MIRT1920798	hsa-miR-1976	CLIP-seq
MIRT1920799	hsa-miR-3160-5p	CLIP-seq
MIRT1920800	hsa-miR-4279	CLIP-seq
MIRT1920801	hsa-miR-4738-5p	CLIP-seq
MIRT1920802	hsa-miR-658	CLIP-seq
MIRT1920803	hsa-miR-766	CLIP-seq
MIRT1920797	hsa-miR-1914	CLIP-seq
MIRT1920798	hsa-miR-1976	CLIP-seq
MIRT1920799	hsa-miR-3160-5p	CLIP-seq
MIRT1920800	hsa-miR-4279	CLIP-seq
MIRT1920801	hsa-miR-4738-5p	CLIP-seq
MIRT1920802	hsa-miR-658	CLIP-seq
MIRT1920803	hsa-miR-766	CLIP-seq
MIRT2075900	hsa-miR-3660	CLIP-seq
MIRT2075901	hsa-miR-4526	CLIP-seq
MIRT1920797	hsa-miR-1914	CLIP-seq
MIRT1920798	hsa-miR-1976	CLIP-seq
MIRT1920799	hsa-miR-3160-5p	CLIP-seq
MIRT1920800	hsa-miR-4279	CLIP-seq
MIRT1920801	hsa-miR-4738-5p	CLIP-seq
MIRT1920802	hsa-miR-658	CLIP-seq
MIRT1920803	hsa-miR-766	CLIP-seq
MIRT1920797	hsa-miR-1914	CLIP-seq
MIRT1920798	hsa-miR-1976	CLIP-seq
MIRT1920799	hsa-miR-3160-5p	CLIP-seq
MIRT1920800	hsa-miR-4279	CLIP-seq
MIRT1920801	hsa-miR-4738-5p	CLIP-seq
MIRT1920802	hsa-miR-658	CLIP-seq
MIRT1920803	hsa-miR-766	CLIP-seq
MIRT1257613	hsa-miR-1228	CLIP-seq
MIRT1257614	hsa-miR-1262	CLIP-seq
MIRT2599181	hsa-miR-3122	CLIP-seq
MIRT1257615	hsa-miR-3151	CLIP-seq
MIRT1257616	hsa-miR-3179	CLIP-seq
MIRT2599182	hsa-miR-3181	CLIP-seq
MIRT2599183	hsa-miR-3689a-3p	CLIP-seq
MIRT2599184	hsa-miR-3689c	CLIP-seq
MIRT2599185	hsa-miR-3913-5p	CLIP-seq
MIRT1257619	hsa-miR-3936	CLIP-seq
MIRT2599186	hsa-miR-3960	CLIP-seq
MIRT1257621	hsa-miR-423-3p	CLIP-seq
MIRT1257622	hsa-miR-4303	CLIP-seq
MIRT2599187	hsa-miR-4467	CLIP-seq
MIRT1257625	hsa-miR-4481	CLIP-seq
MIRT2599188	hsa-miR-4651	CLIP-seq
MIRT1257626	hsa-miR-4682	CLIP-seq
MIRT1257627	hsa-miR-4701-3p	CLIP-seq
MIRT1257628	hsa-miR-4729	CLIP-seq
MIRT1257629	hsa-miR-4745-5p	CLIP-seq
MIRT1257630	hsa-miR-4758-5p	CLIP-seq
MIRT1257631	hsa-miR-4778-5p	CLIP-seq
MIRT2599189	hsa-miR-4797-5p	CLIP-seq
MIRT1257633	hsa-miR-596	CLIP-seq
MIRT2599190	hsa-miR-608	CLIP-seq
MIRT1257613	hsa-miR-1228	CLIP-seq
MIRT1257614	hsa-miR-1262	CLIP-seq
MIRT2688457	hsa-miR-2053	CLIP-seq
MIRT1257615	hsa-miR-3151	CLIP-seq
MIRT1257616	hsa-miR-3179	CLIP-seq
MIRT2599182	hsa-miR-3181	CLIP-seq
MIRT1257619	hsa-miR-3936	CLIP-seq
MIRT2599186	hsa-miR-3960	CLIP-seq
MIRT1257621	hsa-miR-423-3p	CLIP-seq
MIRT2688458	hsa-miR-432	CLIP-seq
MIRT2599187	hsa-miR-4467	CLIP-seq
MIRT1257625	hsa-miR-4481	CLIP-seq
MIRT2599188	hsa-miR-4651	CLIP-seq
MIRT1257627	hsa-miR-4701-3p	CLIP-seq
MIRT1257629	hsa-miR-4745-5p	CLIP-seq
MIRT2688459	hsa-miR-4753-3p	CLIP-seq
MIRT1257630	hsa-miR-4758-5p	CLIP-seq
MIRT2688460	hsa-miR-4764-5p	CLIP-seq
MIRT2688461	hsa-miR-4768-5p	CLIP-seq
MIRT2599189	hsa-miR-4797-5p	CLIP-seq
MIRT2688462	hsa-miR-569	CLIP-seq
MIRT1257633	hsa-miR-596	CLIP-seq
MIRT2599190	hsa-miR-608	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NF1	Unknown	22539979

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA
GO:0000159	Component	Protein phosphatase type 2A complex	IEA
GO:0000159	Component	Protein phosphatase type 2A complex	ISS
GO:0000278	Process	Mitotic cell cycle	ISS
GO:0005515	Function	Protein binding	IPI	25544563, 25816751
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0010458	Process	Exit from mitosis	ISS
GO:0019888	Function	Protein phosphatase regulator activity	IBA
GO:0019888	Function	Protein phosphatase regulator activity	IEA
GO:0019888	Function	Protein phosphatase regulator activity	ISS
GO:0051301	Process	Cell division	IEA
GO:0051983	Process	Regulation of chromosome segregation	IEA
GO:0051983	Process	Regulation of chromosome segregation	ISS
GO:0140767	Function	Enzyme-substrate adaptor activity	IEA
GO:0140767	Function	Enzyme-substrate adaptor activity	ISS

MIM	HGNC	e!Ensembl
613992	23732	ENSG00000175470

Q66LE6

Protein name

Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform (PP2A subunit B isoform B55-delta) (PP2A subunit B isoform PR55-delta) (PP2A subunit B isoform R2-delta) (PP2A subunit B isoform delta)

Protein function

Substrate-recognition subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit. Involved in chromosome clustering during late mitosis by mediating dephosphorylation of MKI67 (By similarit

Family and domains

Sequence

MAGAGGGGCPAGGNDFQWCFSQVKGAIDEDVAEADIISTVEFNYSGDLLATGDKGGRVVI
FQREQENKSRPHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVFVYSSSKGTIRLCDMRSSALCDRHSKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRDTRRDVTLEASRESSKPRASLKPRKVCTGGKRRKDEISVDSLD
FNKKILHTAWHPVDNVIAVAATNNLYIFQDKIN

Sequence length

453

Interactions

View interactions

	KEGG
	mRNA surveillance pathway Sphingolipid signaling pathway PI3K-Akt signaling pathway AMPK signaling pathway Adrenergic signaling in cardiomyocytes Hippo signaling pathway Tight junction T cell receptor signaling pathway Dopaminergic synapse Chagas disease Hepatitis C Human papillomavirus infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	33910530	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrocalcinosis	Associate	32895354	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis Diffuse Idiopathic Skeletal	Associate	32895354	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	38442987	★★★★★ ★☆☆☆☆ Found in Text Mining only
Joint Diseases	Associate	30779748	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media	Associate	24499112	★★★★★ ★☆☆☆☆ Found in Text Mining only
Simpson Golabi Behmel syndrome	Associate	25972378	★★★★★ ★☆☆☆☆ Found in Text Mining only

PPP2R2D (protein phosphatase 2 regulatory subunit Bdelta)