ARHGAP15 (Rho GTPase activating protein 15)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 55843
Gene name Rho GTPase activating protein 15
Gene symbol ARHGAP15
Synonyms (NCBI Gene)
BM046
Chromosome 2
Chromosome location 2q22.2-q22.3
Summary RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
48
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (48)
miRTarBase ID miRNA Experiments Reference
MIRT527122 hsa-miR-548aa PAR-CLIP 22012620
MIRT527121 hsa-miR-548ap-3p PAR-CLIP 22012620
MIRT527120 hsa-miR-548t-3p PAR-CLIP 22012620
MIRT527119 hsa-miR-548as-3p PAR-CLIP 22012620
MIRT527118 hsa-miR-548at-3p PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0005096 Function GTPase activator activity IBA
GO:0005096 Function GTPase activator activity IDA 12650940
GO:0005096 Function GTPase activator activity IEA
GO:0005096 Function GTPase activator activity TAS
GO:0005515 Function Protein binding IPI 28514442, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
610578 21030 ENSG00000075884
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q53QZ3
Protein name Rho GTPase-activating protein 15 (ArhGAP15) (Rho-type GTPase-activating protein 15)
Protein function GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Has activity toward RAC1. Overexpression results in an increase in actin stress fibers and cell contraction.
PDB 3BYI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00169 PH 80 → 189 PH domain Domain
PF00620 RhoGAP 295 → 447 RhoGAP domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung, liver and lymphoid cells. {ECO:0000269|PubMed:12650940}.
Sequence 
MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
RNHSQHILKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKES
KQQALSNMKTGHKPESVDLCGAHIEWAKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDW
FHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHH
SASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKA
SKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFGSEED
Sequence length 475
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    Rho GTPase cycle