ARHGAP15 (Rho GTPase activating protein 15)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55843
Gene name Gene Name - the full gene name approved by the HGNC.
Rho GTPase activating protein 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARHGAP15
Synonyms (NCBI Gene) Gene synonyms aliases
BM046
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q22.2-q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(48)
miRTarBase ID miRNA Experiments Reference
MIRT527122 hsa-miR-548aa PAR-CLIP 22012620
MIRT527121 hsa-miR-548ap-3p PAR-CLIP 22012620
MIRT527120 hsa-miR-548t-3p PAR-CLIP 22012620
MIRT527119 hsa-miR-548as-3p PAR-CLIP 22012620
MIRT527118 hsa-miR-548at-3p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0005096 Function GTPase activator activity IBA
GO:0005096 Function GTPase activator activity IDA 12650940
GO:0005096 Function GTPase activator activity IEA
GO:0005096 Function GTPase activator activity TAS
GO:0005515 Function Protein binding IPI 28514442, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
610578 21030 ENSG00000075884
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q53QZ3
Protein name Rho GTPase-activating protein 15 (ArhGAP15) (Rho-type GTPase-activating protein 15)
Protein function GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Has activity toward RAC1. Overexpression results in an increase in actin stress fibers and cell contraction.
PDB 3BYI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00169 PH 80 → 189 PH domain Domain
PF00620 RhoGAP 295 → 447 RhoGAP domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung, liver and lymphoid cells. {ECO:0000269|PubMed:12650940}.
Sequence 
MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
RNHSQHILKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKES
KQQALSNMKTGHKPESVDLCGAHIEWAKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDW
FHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHH
SASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKA
SKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFGSEED
Sequence length 475
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Rho GTPase cycle
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (10)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Chondromalacia Chondromalacia N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diverticulitis Diverticulitis N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Show/Hide Text Mining Associations (13)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 33280515
Breast Neoplasms Associate 29534468
Cell Transformation Neoplastic Inhibit 29534468
Depressive Disorder Associate 36982982
Diverticular Diseases Associate 28585551, 37196047
Diverticulitis Associate 28585551, 37196047
Diverticulum Associate 37196047
Lung Neoplasms Associate 31298335
Melanoma Associate 35135212
Mowat Wilson syndrome Associate 20145308