Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55829
Gene name	Selenoprotein S
Gene symbol	SELENOS
Synonyms (NCBI Gene)	AD-015ADO15SBBI8SELSSEPS1VIMP
Chromosome	15
Chromosome location	15q26.3
Summary	This gene encodes a transmembrane protein that is localized in the endoplasmic reticulum (ER). It is involved in the degradation process of misfolded proteins in the ER, and may also have a role in inflammation control. This protein is a selenoprotein, co

Show/Hide all (95)

miRTarBase ID	miRNA	Experiments	Reference
MIRT525836	hsa-miR-6771-3p	HITS-CLIP	19536157
MIRT525835	hsa-miR-1295b-5p	HITS-CLIP	19536157
MIRT525834	hsa-miR-1912	HITS-CLIP	19536157
MIRT525833	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT525832	hsa-miR-551a	HITS-CLIP	19536157
MIRT525831	hsa-miR-551b-3p	HITS-CLIP	19536157
MIRT525827	hsa-miR-1225-3p	HITS-CLIP	19536157
MIRT525825	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT525830	hsa-miR-6728-3p	HITS-CLIP	21572407
MIRT525829	hsa-miR-93-3p	HITS-CLIP	21572407
MIRT525828	hsa-miR-3692-5p	HITS-CLIP	21572407
MIRT525826	hsa-miR-558	HITS-CLIP	21572407
MIRT525824	hsa-miR-3194-3p	HITS-CLIP	21572407
MIRT525822	hsa-miR-4300	HITS-CLIP	21572407
MIRT525821	hsa-miR-5591-5p	HITS-CLIP	21572407
MIRT525820	hsa-miR-6726-5p	HITS-CLIP	21572407
MIRT525819	hsa-miR-920	HITS-CLIP	21572407
MIRT525818	hsa-miR-6071	HITS-CLIP	21572407
MIRT525817	hsa-miR-448	HITS-CLIP	21572407
MIRT525816	hsa-miR-5691	HITS-CLIP	21572407
MIRT525815	hsa-miR-6805-3p	HITS-CLIP	21572407
MIRT525830	hsa-miR-6728-3p	HITS-CLIP	23313552
MIRT525829	hsa-miR-93-3p	HITS-CLIP	23313552
MIRT525828	hsa-miR-3692-5p	HITS-CLIP	23313552
MIRT525826	hsa-miR-558	HITS-CLIP	23313552
MIRT525824	hsa-miR-3194-3p	HITS-CLIP	23313552
MIRT525823	hsa-miR-184	HITS-CLIP	23313552
MIRT525822	hsa-miR-4300	HITS-CLIP	23313552
MIRT525821	hsa-miR-5591-5p	HITS-CLIP	23313552
MIRT525820	hsa-miR-6726-5p	HITS-CLIP	23313552
MIRT525819	hsa-miR-920	HITS-CLIP	23313552
MIRT525818	hsa-miR-6071	HITS-CLIP	23313552
MIRT525817	hsa-miR-448	HITS-CLIP	23313552
MIRT525816	hsa-miR-5691	HITS-CLIP	23313552
MIRT525815	hsa-miR-6805-3p	HITS-CLIP	23313552
MIRT525814	hsa-miR-4804-5p	HITS-CLIP	23313552
MIRT525830	hsa-miR-6728-3p	HITS-CLIP	24906430
MIRT525829	hsa-miR-93-3p	HITS-CLIP	24906430
MIRT525828	hsa-miR-3692-5p	HITS-CLIP	24906430
MIRT525826	hsa-miR-558	HITS-CLIP	24906430
MIRT525824	hsa-miR-3194-3p	HITS-CLIP	24906430
MIRT525822	hsa-miR-4300	HITS-CLIP	24906430
MIRT525821	hsa-miR-5591-5p	HITS-CLIP	24906430
MIRT525820	hsa-miR-6726-5p	HITS-CLIP	24906430
MIRT525819	hsa-miR-920	HITS-CLIP	24906430
MIRT525818	hsa-miR-6071	HITS-CLIP	24906430
MIRT525817	hsa-miR-448	HITS-CLIP	24906430
MIRT525816	hsa-miR-5691	HITS-CLIP	24906430
MIRT525815	hsa-miR-6805-3p	HITS-CLIP	24906430
MIRT525836	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT525835	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT525834	hsa-miR-1912	PAR-CLIP	20371350
MIRT525833	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT525832	hsa-miR-551a	PAR-CLIP	20371350
MIRT525831	hsa-miR-551b-3p	PAR-CLIP	20371350
MIRT525827	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT525817	hsa-miR-448	PAR-CLIP	20371350
MIRT525830	hsa-miR-6728-3p	PAR-CLIP	20371350
MIRT525829	hsa-miR-93-3p	PAR-CLIP	20371350
MIRT525828	hsa-miR-3692-5p	PAR-CLIP	20371350
MIRT525826	hsa-miR-558	PAR-CLIP	20371350
MIRT525824	hsa-miR-3194-3p	PAR-CLIP	20371350
MIRT525823	hsa-miR-184	PAR-CLIP	20371350
MIRT525822	hsa-miR-4300	PAR-CLIP	20371350
MIRT525821	hsa-miR-5591-5p	PAR-CLIP	20371350
MIRT525820	hsa-miR-6726-5p	PAR-CLIP	20371350
MIRT525819	hsa-miR-920	PAR-CLIP	20371350
MIRT525818	hsa-miR-6071	PAR-CLIP	20371350
MIRT525817	hsa-miR-448	PAR-CLIP	20371350
MIRT525816	hsa-miR-5691	PAR-CLIP	20371350
MIRT525815	hsa-miR-6805-3p	PAR-CLIP	20371350
MIRT525814	hsa-miR-4804-5p	PAR-CLIP	20371350
MIRT525836	hsa-miR-6771-3p	PAR-CLIP	22012620
MIRT525835	hsa-miR-1295b-5p	PAR-CLIP	22012620
MIRT525834	hsa-miR-1912	PAR-CLIP	22012620
MIRT525833	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT525832	hsa-miR-551a	PAR-CLIP	22012620
MIRT525831	hsa-miR-551b-3p	PAR-CLIP	22012620
MIRT525830	hsa-miR-6728-3p	PAR-CLIP	22012620
MIRT525829	hsa-miR-93-3p	PAR-CLIP	22012620
MIRT525828	hsa-miR-3692-5p	PAR-CLIP	22012620
MIRT525827	hsa-miR-1225-3p	PAR-CLIP	22012620
MIRT525826	hsa-miR-558	PAR-CLIP	22012620
MIRT525825	hsa-miR-4749-3p	PAR-CLIP	22012620
MIRT525824	hsa-miR-3194-3p	PAR-CLIP	22012620
MIRT525823	hsa-miR-184	PAR-CLIP	22012620
MIRT525822	hsa-miR-4300	PAR-CLIP	22012620
MIRT525821	hsa-miR-5591-5p	PAR-CLIP	22012620
MIRT525820	hsa-miR-6726-5p	PAR-CLIP	22012620
MIRT525819	hsa-miR-920	PAR-CLIP	22012620
MIRT525818	hsa-miR-6071	PAR-CLIP	22012620
MIRT525817	hsa-miR-448	PAR-CLIP	22012620
MIRT525816	hsa-miR-5691	PAR-CLIP	22012620
MIRT525815	hsa-miR-6805-3p	PAR-CLIP	22012620
MIRT525814	hsa-miR-4804-5p	PAR-CLIP	22012620

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002865	Process	Negative regulation of acute inflammatory response to antigenic stimulus	IMP	18675776
GO:0005515	Function	Protein binding	IPI	15215856, 32296183, 32353859, 33060197, 36217030
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	16186510
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	15215856
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005881	Component	Cytoplasmic microtubule	IDA	23264731
GO:0005886	Component	Plasma membrane	TAS	12663463
GO:0006111	Process	Regulation of gluconeogenesis	TAS	12663463
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006983	Process	ER overload response	IDA	16574427
GO:0006983	Process	ER overload response	IMP	17210132
GO:0009749	Process	Response to glucose	IEP	12031974, 15063746
GO:0016020	Component	Membrane	IEA
GO:0016209	Function	Antioxidant activity	IDA	15063746
GO:0019899	Function	Enzyme binding	IPI	15215856
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IBA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	15215856
GO:0030970	Process	Retrograde protein transport, ER to cytosol	IBA
GO:0030970	Process	Retrograde protein transport, ER to cytosol	IDA	15215856
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	ISS
GO:0032869	Process	Cellular response to insulin stimulus	TAS	12663463
GO:0034361	Component	Very-low-density lipoprotein particle	IDA	17374524
GO:0034362	Component	Low-density lipoprotein particle	IDA	17374524
GO:0034599	Process	Cellular response to oxidative stress	IMP	18675776
GO:0036502	Component	Derlin-1-VIMP complex	IBA
GO:0036502	Component	Derlin-1-VIMP complex	IDA	15215856
GO:0036503	Process	ERAD pathway	IDA	15215856
GO:0036513	Component	Derlin-1 retrotranslocation complex	IBA
GO:0036513	Component	Derlin-1 retrotranslocation complex	IDA	15215856
GO:0038023	Function	Signaling receptor activity	NAS	15215856
GO:0045184	Process	Establishment of protein localization	TAS	15215856
GO:0045454	Process	Cell redox homeostasis	IDA	15063746
GO:0045719	Process	Negative regulation of glycogen biosynthetic process	TAS	12663463
GO:0046325	Process	Negative regulation of D-glucose import	TAS	12663463
GO:0050728	Process	Negative regulation of inflammatory response	IC	16574427
GO:0051117	Function	ATPase binding	IPI	24424410
GO:0051775	Process	Response to redox state	IDA	15063746
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	18675776
GO:0080164	Process	Regulation of nitric oxide metabolic process	IMP	18675776
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IMP	17210132
GO:1990381	Function	Ubiquitin-specific protease binding	IPI	17000876
GO:2000110	Process	Negative regulation of macrophage apoptotic process	IMP	17210132

MIM	HGNC	e!Ensembl
607918	30396	ENSG00000131871

Q9BQE4

Protein name

Selenoprotein S (SelS) (VCP-interacting membrane protein)

Protein function

Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent mann

PDB

2Q2F , 5KIU , 5KIY , 6DO4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06936	Selenoprotein_S	1 → 187	Selenoprotein S (SelS)	Family

Sequence

MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQ
RQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWD
SMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
RGPSSGGUG

Sequence length

189

Interactions

View interactions

	KEGG		Reactome
	Protein processing in endoplasmic reticulum		E3 ubiquitin ligases ubiquitinate target proteins

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs79140824	RCV005903710
Adrenocortical carcinoma, hereditary	Benign	rs79140824	RCV005903713
Cervical cancer	Benign	rs79140824	RCV005903714
Cholangiocarcinoma	Benign	rs79140824	RCV005903723
Clear cell carcinoma of kidney	Benign	rs79140824	RCV005903715
Colon adenocarcinoma	Benign	rs79140824	RCV005903709
Colorectal cancer	Benign	rs79140824	RCV005903716
Gastric cancer	Benign	rs79140824	RCV005903718
Lung cancer	Benign	rs79140824	RCV005903724
Malignant tumor of esophagus	Benign	rs79140824	RCV005903711
Nonpapillary renal cell carcinoma	Benign	rs79140824	RCV005903712
Ovarian serous cystadenocarcinoma	Benign	rs79140824	RCV005903719
Sarcoma	Benign	rs79140824	RCV005903717
Thymoma	Benign	rs79140824	RCV005903721
Thyroid cancer, nonmedullary, 1	Benign	rs79140824	RCV005903722
Uterine carcinosarcoma	Benign	rs79140824	RCV005903720
Uterine corpus endometrial carcinoma	Benign	rs79140824	RCV005903725

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenoma	Associate	30469315
alpha 1 Antitrypsin Deficiency	Associate	19398551
Alzheimer Disease	Associate	27802219
Aortic Aneurysm Abdominal	Associate	30188935
Asthma	Associate	22069270
Atherosclerosis	Associate	30188935, 35795669
Breast Neoplasms	Associate	24278290
Carcinoma Hepatocellular	Associate	26708178
Cardiovascular Diseases	Associate	20619427, 23161441, 30889154
Cerebral Hemorrhage	Stimulate	40004116
Cerebral Infarction	Associate	18974842
Cerebral Infarction	Stimulate	40004116
Colorectal Neoplasms	Associate	22615972, 35807897, 38049731
Dermatitis Atopic	Associate	22069270
Diabetes Complications	Associate	35806251
Diabetes Mellitus	Associate	30413610
Diabetes Mellitus Type 1	Associate	22069270
Diabetes Mellitus Type 2	Associate	20619427, 23161441, 30413610, 31265177
Diabetic Nephropathies	Associate	31265177
Diffuse Neurofibrillary Tangles with Calcification	Associate	27802219
Drug Related Side Effects and Adverse Reactions	Associate	15063746
Fibrosis	Associate	31880214
Inflammation	Associate	19036615, 19144102, 20619427, 23161441, 30889154, 40004116
Inflammation	Inhibit	31265177
Insulin Resistance	Associate	20619427, 35806251
Kashin Beck Disease	Associate	25433273
Neoplasms	Associate	35807897
Neurodegenerative Diseases	Associate	27802219
Obesity	Associate	20619427
Ovarian Neoplasms	Associate	34075060
Peripheral Arterial Disease	Associate	30188935
Peripheral Nervous System Diseases	Associate	30188935
Rectal Neoplasms	Associate	25330801
Stomach Neoplasms	Associate	19144102
Stroke	Associate	40004116

SELENOS (selenoprotein S)