RNF130 (ring finger protein 130)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55819
Gene name Gene Name - the full gene name approved by the HGNC.
Ring finger protein 130
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RNF130
Synonyms (NCBI Gene) Gene synonyms aliases
G1RP, G1RZFP, GOLIATH, GP
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a RING finger motif and is similar to g1, a Drosophila zinc-finger protein that is expressed in mesoderm and involved in embryonic development. The expression of the mouse counterpart was found to be upregulated i
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT044645 hsa-miR-320a CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IDA 16549277
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005737 Component Cytoplasm IDA 16549277
GO:0006511 Process Ubiquitin-dependent protein catabolic process IBA 21873635
GO:0006915 Process Apoptotic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
619163 18280 ENSG00000113269
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q86XS8
Protein name E3 ubiquitin-protein ligase RNF130 (EC 2.3.2.27) (Goliath homolog) (H-Goliath) (RING finger protein 130) (RING-type E3 ubiquitin transferase RNF130)
Protein function May have a role during the programmed cell death of hematopoietic cells (By similarity). Acts as an E3 ubiquitin-protein ligase.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02225 PA 70 → 165 PA domain Family
PF13639 zf-RING_2 262 → 305 Ring finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Highly expressed in leukocytes. Not expressed in erythroblasts. {ECO:0000269|PubMed:16549277}.
Sequence 
MSCAGRAGPARLAALALLTCSLWPARADNASQEYYTALINVTVQEPGRGAPLTFRIDRGR
YGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKIS
RAAFHNAVAVVIYNNKSKEEPVTMTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIA
VGTRMPPKNFSRGSLVFVSISFIVLMIISSAWLIFYFIQKIRYTNARDRNQRRLGDAAKK
AISKLTTRTVKKGDKETDPDFDHCAVCIESYKQNDVVRILPCKHVFHKSCVDPWLSEHCT
CPMCKLNILKALGIVPNLPCTDNVAFDMERLTRTQAVNRRSALGDLAGDNSLGLEPLRTS
GISPLPQDGELTPRTGEINIAVTKEWFIIASFGLLSALTLCYMIIRATASLNANEVEWF
Sequence length 419
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 17013881
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Coronary heart disease Coronary heart disease 21347282 ClinVar
Insomnia Insomnia GWAS
Show/Hide Text Mining Associations (22)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 25228972
Barrett Esophagus Associate 25228972
Colorectal Neoplasms Associate 23337790, 25787909, 31168022
Death Associate 32491001
Esophageal Neoplasms Associate 25228972
Frontotemporal Dementia Associate 37696852
Glycogen Storage Disease Type V Associate 20957198, 8408630
Glycogen Storage Disease Type V Inhibit 22347505
Heart Failure Associate 32491001
Hemorrhage Associate 20823666, 37702365