Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55818
Gene name Gene Name - the full gene name approved by the HGNC.	Lysine demethylase 3A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KDM3A
Synonyms (NCBI Gene) Gene synonyms aliases	JHDM2A, JHMD2A, JMJD1, JMJD1A, TSGA
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a zinc finger protein that contains a jumonji domain and may play a role in hormone-dependent transcriptional activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]

Show/Hide all(200)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT040574	hsa-miR-92b-3p	CLASH	23622248
MIRT437860	hsa-miR-627-5p	GFP reporter assay, Western blot	23619147
MIRT437860	hsa-miR-627-5p	GFP reporter assay, Western blot	23619147
MIRT727399	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727398	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727396	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727397	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727395	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT732931	hsa-miR-335-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33888871
MIRT733599	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blotting	31755219
MIRT733599	hsa-miR-22-3p	Luciferase reporter assay, Immunoprecipitaion (IP), qRT-PCR	31755219
MIRT1084338	hsa-let-7a	CLIP-seq
MIRT1084339	hsa-let-7b	CLIP-seq
MIRT1084340	hsa-let-7c	CLIP-seq
MIRT1084341	hsa-let-7d	CLIP-seq
MIRT1084342	hsa-let-7e	CLIP-seq
MIRT1084343	hsa-let-7f	CLIP-seq
MIRT1084344	hsa-let-7g	CLIP-seq
MIRT1084345	hsa-let-7i	CLIP-seq
MIRT1084346	hsa-miR-1253	CLIP-seq
MIRT1084347	hsa-miR-128	CLIP-seq
MIRT1084348	hsa-miR-155	CLIP-seq
MIRT1084349	hsa-miR-202	CLIP-seq
MIRT1084350	hsa-miR-216a	CLIP-seq
MIRT1084351	hsa-miR-224	CLIP-seq
MIRT1084352	hsa-miR-27a	CLIP-seq
MIRT1084353	hsa-miR-27b	CLIP-seq
MIRT1084354	hsa-miR-30a	CLIP-seq
MIRT1084355	hsa-miR-30b	CLIP-seq
MIRT1084356	hsa-miR-30c	CLIP-seq
MIRT1084357	hsa-miR-30d	CLIP-seq
MIRT1084358	hsa-miR-30e	CLIP-seq
MIRT1084359	hsa-miR-3120-5p	CLIP-seq
MIRT1084360	hsa-miR-3121-3p	CLIP-seq
MIRT1084361	hsa-miR-3607-3p	CLIP-seq
MIRT1084362	hsa-miR-3686	CLIP-seq
MIRT1084363	hsa-miR-371-5p	CLIP-seq
MIRT1084364	hsa-miR-371b-5p	CLIP-seq
MIRT1084365	hsa-miR-4458	CLIP-seq
MIRT1084366	hsa-miR-4477b	CLIP-seq
MIRT1084367	hsa-miR-4500	CLIP-seq
MIRT1084368	hsa-miR-4643	CLIP-seq
MIRT1084369	hsa-miR-466	CLIP-seq
MIRT1084370	hsa-miR-4693-5p	CLIP-seq
MIRT1084371	hsa-miR-4698	CLIP-seq
MIRT1084372	hsa-miR-4699-3p	CLIP-seq
MIRT1084373	hsa-miR-4704-5p	CLIP-seq
MIRT1084374	hsa-miR-4720-3p	CLIP-seq
MIRT1084375	hsa-miR-4789-3p	CLIP-seq
MIRT1084376	hsa-miR-4789-5p	CLIP-seq
MIRT1084377	hsa-miR-4804-3p	CLIP-seq
MIRT1084378	hsa-miR-98	CLIP-seq
MIRT1084361	hsa-miR-3607-3p	CLIP-seq
MIRT2021410	hsa-miR-3944-5p	CLIP-seq
MIRT2021411	hsa-miR-4760-3p	CLIP-seq
MIRT2021412	hsa-miR-579	CLIP-seq
MIRT2021413	hsa-miR-664	CLIP-seq
MIRT1084338	hsa-let-7a	CLIP-seq
MIRT1084339	hsa-let-7b	CLIP-seq
MIRT1084340	hsa-let-7c	CLIP-seq
MIRT1084341	hsa-let-7d	CLIP-seq
MIRT1084342	hsa-let-7e	CLIP-seq
MIRT1084343	hsa-let-7f	CLIP-seq
MIRT1084344	hsa-let-7g	CLIP-seq
MIRT1084345	hsa-let-7i	CLIP-seq
MIRT1084346	hsa-miR-1253	CLIP-seq
MIRT1084347	hsa-miR-128	CLIP-seq
MIRT2252865	hsa-miR-1911	CLIP-seq
MIRT1084349	hsa-miR-202	CLIP-seq
MIRT1084350	hsa-miR-216a	CLIP-seq
MIRT2252866	hsa-miR-22	CLIP-seq
MIRT1084351	hsa-miR-224	CLIP-seq
MIRT1084352	hsa-miR-27a	CLIP-seq
MIRT1084353	hsa-miR-27b	CLIP-seq
MIRT1084354	hsa-miR-30a	CLIP-seq
MIRT1084355	hsa-miR-30b	CLIP-seq
MIRT1084356	hsa-miR-30c	CLIP-seq
MIRT1084357	hsa-miR-30d	CLIP-seq
MIRT1084358	hsa-miR-30e	CLIP-seq
MIRT1084359	hsa-miR-3120-5p	CLIP-seq
MIRT1084360	hsa-miR-3121-3p	CLIP-seq
MIRT2252867	hsa-miR-3130-3p	CLIP-seq
MIRT2252868	hsa-miR-3185	CLIP-seq
MIRT2252869	hsa-miR-323-3p	CLIP-seq
MIRT1084361	hsa-miR-3607-3p	CLIP-seq
MIRT1084362	hsa-miR-3686	CLIP-seq
MIRT1084363	hsa-miR-371-5p	CLIP-seq
MIRT1084364	hsa-miR-371b-5p	CLIP-seq
MIRT2252870	hsa-miR-382	CLIP-seq
MIRT2021410	hsa-miR-3944-5p	CLIP-seq
MIRT2252871	hsa-miR-3973	CLIP-seq
MIRT2252872	hsa-miR-410	CLIP-seq
MIRT2252873	hsa-miR-4259	CLIP-seq
MIRT2252874	hsa-miR-4457	CLIP-seq
MIRT1084365	hsa-miR-4458	CLIP-seq
MIRT1084366	hsa-miR-4477b	CLIP-seq
MIRT1084367	hsa-miR-4500	CLIP-seq
MIRT1084368	hsa-miR-4643	CLIP-seq
MIRT1084369	hsa-miR-466	CLIP-seq
MIRT1084370	hsa-miR-4693-5p	CLIP-seq
MIRT1084372	hsa-miR-4699-3p	CLIP-seq
MIRT1084373	hsa-miR-4704-5p	CLIP-seq
MIRT2252875	hsa-miR-4709-3p	CLIP-seq
MIRT2252876	hsa-miR-4722-3p	CLIP-seq
MIRT2021411	hsa-miR-4760-3p	CLIP-seq
MIRT1084375	hsa-miR-4789-3p	CLIP-seq
MIRT1084376	hsa-miR-4789-5p	CLIP-seq
MIRT2252877	hsa-miR-4793-3p	CLIP-seq
MIRT2252878	hsa-miR-4797-5p	CLIP-seq
MIRT2252879	hsa-miR-513b	CLIP-seq
MIRT2252880	hsa-miR-520g	CLIP-seq
MIRT2252881	hsa-miR-520h	CLIP-seq
MIRT2252882	hsa-miR-544	CLIP-seq
MIRT2252883	hsa-miR-548n	CLIP-seq
MIRT2252884	hsa-miR-548t	CLIP-seq
MIRT2021412	hsa-miR-579	CLIP-seq
MIRT2021413	hsa-miR-664	CLIP-seq
MIRT1084378	hsa-miR-98	CLIP-seq
MIRT1084350	hsa-miR-216a	CLIP-seq
MIRT2252873	hsa-miR-4259	CLIP-seq
MIRT2252874	hsa-miR-4457	CLIP-seq
MIRT2252879	hsa-miR-513b	CLIP-seq
MIRT1084346	hsa-miR-1253	CLIP-seq
MIRT1084347	hsa-miR-128	CLIP-seq
MIRT1084351	hsa-miR-224	CLIP-seq
MIRT1084352	hsa-miR-27a	CLIP-seq
MIRT1084353	hsa-miR-27b	CLIP-seq
MIRT1084354	hsa-miR-30a	CLIP-seq
MIRT1084355	hsa-miR-30b	CLIP-seq
MIRT1084356	hsa-miR-30c	CLIP-seq
MIRT1084357	hsa-miR-30d	CLIP-seq
MIRT1084358	hsa-miR-30e	CLIP-seq
MIRT1084359	hsa-miR-3120-5p	CLIP-seq
MIRT1084360	hsa-miR-3121-3p	CLIP-seq
MIRT2252867	hsa-miR-3130-3p	CLIP-seq
MIRT2555904	hsa-miR-3140-3p	CLIP-seq
MIRT1084361	hsa-miR-3607-3p	CLIP-seq
MIRT1084362	hsa-miR-3686	CLIP-seq
MIRT1084366	hsa-miR-4477b	CLIP-seq
MIRT2555905	hsa-miR-4490	CLIP-seq
MIRT1084368	hsa-miR-4643	CLIP-seq
MIRT1084369	hsa-miR-466	CLIP-seq
MIRT1084370	hsa-miR-4693-5p	CLIP-seq
MIRT1084372	hsa-miR-4699-3p	CLIP-seq
MIRT1084373	hsa-miR-4704-5p	CLIP-seq
MIRT1084375	hsa-miR-4789-3p	CLIP-seq
MIRT1084376	hsa-miR-4789-5p	CLIP-seq
MIRT2252877	hsa-miR-4793-3p	CLIP-seq
MIRT2252882	hsa-miR-544	CLIP-seq
MIRT2252883	hsa-miR-548n	CLIP-seq
MIRT2252884	hsa-miR-548t	CLIP-seq
MIRT1084346	hsa-miR-1253	CLIP-seq
MIRT1084347	hsa-miR-128	CLIP-seq
MIRT1084351	hsa-miR-224	CLIP-seq
MIRT1084352	hsa-miR-27a	CLIP-seq
MIRT1084353	hsa-miR-27b	CLIP-seq
MIRT1084354	hsa-miR-30a	CLIP-seq
MIRT1084355	hsa-miR-30b	CLIP-seq
MIRT1084356	hsa-miR-30c	CLIP-seq
MIRT1084357	hsa-miR-30d	CLIP-seq
MIRT1084358	hsa-miR-30e	CLIP-seq
MIRT1084359	hsa-miR-3120-5p	CLIP-seq
MIRT1084360	hsa-miR-3121-3p	CLIP-seq
MIRT2252867	hsa-miR-3130-3p	CLIP-seq
MIRT2555904	hsa-miR-3140-3p	CLIP-seq
MIRT1084361	hsa-miR-3607-3p	CLIP-seq
MIRT1084362	hsa-miR-3686	CLIP-seq
MIRT1084366	hsa-miR-4477b	CLIP-seq
MIRT2555905	hsa-miR-4490	CLIP-seq
MIRT1084368	hsa-miR-4643	CLIP-seq
MIRT1084369	hsa-miR-466	CLIP-seq
MIRT1084370	hsa-miR-4693-5p	CLIP-seq
MIRT1084372	hsa-miR-4699-3p	CLIP-seq
MIRT1084375	hsa-miR-4789-3p	CLIP-seq
MIRT1084376	hsa-miR-4789-5p	CLIP-seq
MIRT2252877	hsa-miR-4793-3p	CLIP-seq
MIRT2252882	hsa-miR-544	CLIP-seq
MIRT2252883	hsa-miR-548n	CLIP-seq
MIRT2252884	hsa-miR-548t	CLIP-seq

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IBA
GO:0000785	Component	Chromatin	IBA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005506	Function	Iron ion binding	IMP	16603237
GO:0005515	Function	Protein binding	IPI	25535969, 37179361
GO:0005634	Component	Nucleus	IDA	16603237
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007290	Process	Spermatid nucleus elongation	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	16603237
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030521	Process	Androgen receptor signaling pathway	IDA	16603237
GO:0031490	Function	Chromatin DNA binding	IBA
GO:0032454	Function	Histone H3K9 demethylase activity	IBA
GO:0032454	Function	Histone H3K9 demethylase activity	IEA
GO:0032454	Function	Histone H3K9 demethylase activity	IMP	28262558
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	16603237
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046293	Process	Formaldehyde biosynthetic process	IDA	16603237
GO:0046872	Function	Metal ion binding	IEA
GO:0050681	Function	Nuclear androgen receptor binding	IDA	16603237
GO:0051213	Function	Dioxygenase activity	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	19194461
GO:0140683	Function	Histone H3K9me/H3K9me2 demethylase activity	IDA	16603237
GO:0140683	Function	Histone H3K9me/H3K9me2 demethylase activity	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000036	Process	Regulation of stem cell population maintenance	IEA
GO:2000736	Process	Regulation of stem cell differentiation	IEA

MIM	HGNC	e!Ensembl
611512	20815	ENSG00000115548

Protein

UniProt ID

Q9Y4C1

Protein name

Lysine-specific demethylase 3A (EC 1.14.11.65) (JmjC domain-containing histone demethylation protein 2A) (Jumonji domain-containing protein 1A) ([histone H3]-dimethyl-L-lysine(9) demethylase 3A)

Protein function

Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Preferentially demethylates mono- and dimethylated H3 'Lys-9' residue, with a preference for dimethylated residue, while it

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02373	JmjC	1151 → 1264	JmjC domain, hydroxylase	Domain

Sequence

MVLTLGESWPVLVGRRFLSLSAADGSDGSHDSWDVERVAEWPWLSGTIRAVSHTDVTKKD
LKVCVEFDGESWRKRRWIEVYSLLRRAFLVEHNLVLAERKSPEISERIVQWPAITYKPLL
DKAGLGSITSVRFLGDQQRVFLSKDLLKPIQDVNSLRLSLTDNQIVSKEFQALIVKHLDE
SHLLKGDKNLVGSEVKIYSLDPSTQWFSATVINGNPASKTLQVNCEEIPALKIVDPSLIH
VEVVHDNLVTCGNSARIGAVKRKSSENNGTLVSKQAKSCSEASPSMCPVQSVPTTVFKEI
LLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCLNTKSEALRTK
PDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPT
KASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACR
SQNLKESSVKVDNESCCSRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIV
AQLPKCRECRLDSLRKDKEQQKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDNEAI
GLWLPLTKNVVGIDLDTAKYILANIGDHFCQMVISEKEAMSTIEPHRQVAWKRAVKGVRE
MCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAAYKTFSWLKCVKSQIHEPENL
MPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPASKEDLKQTSLAGEKP
TLGAVLQQNPSVLEPAAVGGEAASKPAGSMKPACPASTSPLNWLADLTSGNVNKENKEKQ
PTMPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGL
KNTPKILDDIFASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNK
SNWNVFRECWKQGQPVMVSGVHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATV
GDFWDGFEDVPNRLKNEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRDGK
LNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKGQC
EQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQEN
PADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKV
AEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSFGK
P

Sequence length

1321

Interactions

View interactions

	KEGG		Reactome
	Thermogenesis		HDMs demethylate histones NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	25488809, 38165573
Carcinogenesis	Associate	26617828, 26728187, 33174020
Carcinogenesis	Stimulate	33888871
Carcinoma Hepatocellular	Associate	36008383
Carcinoma Renal Cell	Stimulate	33888871
Colonic Neoplasms	Associate	37650153
Colorectal Neoplasms	Associate	30649550, 32457453, 33174020
Esophageal Squamous Cell Carcinoma	Associate	33318475
Hyperglycemia	Associate	34479471
Hypoxia	Associate	18984585, 24002598, 28416760, 34479471, 37650153
Hypoxia	Stimulate	29444873, 33318475
Hypoxia Brain	Stimulate	18984585
Hypoxia Brain	Associate	33318475
Infertility	Associate	30053768
Infertility Male	Associate	30053768, 34235877
Inflammation	Associate	34479471, 36959678
Kidney Neoplasms	Stimulate	18984585
Lung Neoplasms	Associate	34044859
Lymphatic Metastasis	Associate	27835890, 29590186
Lymphatic Metastasis	Stimulate	34171978
Male Infertility with Large Headed Multiflagellar Polyploid Spermatozoa	Associate	30053768
Multiple Myeloma	Associate	26728187, 29444873
Nasopharyngeal Carcinoma	Associate	21541331
Neoplasm Metastasis	Stimulate	33888871, 38165573
Neoplasms	Associate	26617828, 27835890, 28416760, 29590186, 30649550, 34171978
Neoplasms	Inhibit	32457453, 32762126
Neoplasms	Stimulate	35020958, 38165573
Neuroblastoma	Associate	24742640
Oropharyngeal Neoplasms	Associate	29590186
Pancreatic Neoplasms	Associate	24002598, 32779232, 34171978
Personality Disorders	Stimulate	34044859
Prostatic Neoplasms	Associate	25189356, 26279298, 28416760
Rhabdomyosarcoma	Associate	32697014
Spinal Cord Injuries	Associate	36959678
Squamous Cell Carcinoma of Head and Neck	Associate	29590186
Stomach Neoplasms	Stimulate	26617828
Stomach Neoplasms	Inhibit	32762126
Tertiary Lymphoid Structures	Stimulate	26617828
Triple Negative Breast Neoplasms	Associate	34779768, 38165573
Uterine Cervical Neoplasms	Stimulate	27835890
Vascular System Injuries	Associate	34479471
Young Syndrome	Associate	27027467

KDM3A (lysine demethylase 3A)