Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55801
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 26
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL26
Synonyms (NCBI Gene) Gene synonyms aliases	AK155, IL-26
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q15
Summary Summary of gene provided in NCBI Entrez Gene.	This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments
MIRT2015379	hsa-miR-151-3p	CLIP-seq
MIRT2015380	hsa-miR-3152-3p	CLIP-seq
MIRT2015381	hsa-miR-340	CLIP-seq
MIRT2015382	hsa-miR-4463	CLIP-seq
MIRT2015383	hsa-miR-4499	CLIP-seq
MIRT2015384	hsa-miR-4668-3p	CLIP-seq
MIRT2015385	hsa-miR-4698	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IDA	18483078
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	18483078
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18483078
GO:0005615	Component	Extracellular space	IEA
GO:0005829	Component	Cytosol	IDA	18483078
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007267	Process	Cell-cell signaling	TAS	10729163
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IDA	18483078
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18483078
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	18483078
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	18483078
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	18483078
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	18483078

MIM	HGNC	e!Ensembl
605679	17119	ENSG00000111536

Protein

UniProt ID

Q9NPH9

Protein name

Interleukin-26 (IL-26) (Protein AK155)

Protein function

May play a role in local mechanisms of mucosal immunity and seems to have a pro-inflammatory function. May play a role in inflammatory bowel disease. Activates STAT1 and STAT3, MAPK1/3 (ERK1/2), JUN and AKT. Induces expression of SOCS3, TNF-alph

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00726	IL10	6 → 168	Interleukin 10	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in HVS transformed T-cells but not other T-cell lines or primary stimulated T-cells. Expressed in colonic T-cells including Th17 inflammatory T-cells; the expression is significantly increased in serum of patients with Crohn'

Sequence

MLVNFILRCGLLLVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDR
IKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLRQKLSH
CISCASSAREMKSITRMKRIFYRIGNKGIYKAISELDILLSWIKKLLESSQ

Sequence length

171

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway		Interleukin-20 family signaling

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arthritis	Associate	34572149
Arthritis Rheumatoid	Associate	14558082, 31831038
Arthritis Rheumatoid	Stimulate	23055831
Asthma	Associate	35188435
Bacterial Infections	Associate	34777376
Bronchitis Chronic	Stimulate	29780024
Carcinoma Renal Cell	Stimulate	40612864
Colitis Ulcerative	Associate	20176734
Colonic Neoplasms	Associate	15178681
COVID 19	Associate	36466824
Crohn Disease	Stimulate	23055831
Eclampsia	Stimulate	22958187
Infections	Inhibit	25157980
Inflammation	Associate	28852311, 30972071, 34572149, 35188435
Inflammation	Stimulate	29780024
Inflammatory Bowel Diseases	Stimulate	28852311
Leprosy Lepromatous	Associate	30939123
Leprosy Tuberculoid	Associate	30939123
Lung Diseases	Associate	29780024
Lymphoma Large Cell Anaplastic	Associate	29588546
Lymphoma T Cell Cutaneous	Associate	25779945
Multiple Sclerosis	Associate	14558082, 35008743
Mycosis Fungoides	Associate	25779945
Mysophobia	Inhibit	34777376
Neoplasms	Associate	31948053
Neoplasms	Stimulate	40612864
Pancreatic Neoplasms	Associate	31948053
Pneumonia	Associate	34777376
Pneumonia Bacterial	Associate	34777376
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	23055831
Pulmonary Disease Chronic Obstructive	Associate	35188435
Pulmonary Disease Chronic Obstructive	Stimulate	40158635
Sezary Syndrome	Associate	25779945
Soft Tissue Injuries	Associate	36466824
Stomach Neoplasms	Associate	23704922
Tuberculosis	Inhibit	25157980

IL26 (interleukin 26)