IL26 (interleukin 26)

Gene

• Entrez ID: 55801
• Gene name: Interleukin 26
• Gene symbol: IL26
• Synonyms (NCBI Gene): AK155, IL-26
• Chromosome: 12
• Chromosome location: 12q15
• Summary: This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2015379	hsa-miR-151-3p	CLIP-seq
MIRT2015380	hsa-miR-3152-3p	CLIP-seq
MIRT2015381	hsa-miR-340	CLIP-seq
MIRT2015382	hsa-miR-4463	CLIP-seq
MIRT2015383	hsa-miR-4499	CLIP-seq
MIRT2015384	hsa-miR-4668-3p	CLIP-seq
MIRT2015385	hsa-miR-4698	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IDA	18483078
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	18483078
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18483078
GO:0005615	Component	Extracellular space	IEA
GO:0005829	Component	Cytosol	IDA	18483078
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007267	Process	Cell-cell signaling	TAS	10729163
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IDA	18483078
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18483078
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	18483078
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	18483078
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	18483078
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	18483078

Other IDs

• MIM: 605679
• HGNC: 17119
• e!Ensembl: ENSG00000111536

Protein

• UniProt ID: Q9NPH9
• Protein name: Interleukin-26 (IL-26) (Protein AK155)
• Protein function: May play a role in local mechanisms of mucosal immunity and seems to have a pro-inflammatory function. May play a role in inflammatory bowel disease. Activates STAT1 and STAT3, MAPK1/3 (ERK1/2), JUN and AKT. Induces expression of SOCS3, TNF-alph
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00726	IL10	6 → 168	Interleukin 10	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in HVS transformed T-cells but not other T-cell lines or primary stimulated T-cells. Expressed in colonic T-cells including Th17 inflammatory T-cells; the expression is significantly increased in serum of patients with Crohn'
• Sequence:

  MLVNFILRCGLLLVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDR
  IKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLRQKLSH
  CISCASSAREMKSITRMKRIFYRIGNKGIYKAISELDILLSWIKKLLESSQ

• Sequence length: 171

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway

Reactome:

Interleukin-20 family signaling