PCID2 (PCI domain containing 2)

Gene

• Entrez ID: 55795
• Gene name: PCI domain containing 2
• Gene symbol: PCID2
• Synonyms (NCBI Gene): F10
• Chromosome: 13
• Chromosome location: 13q34
• Summary: This gene encodes a component of the TREX-2 complex (transcription and export complex 2), which regulates mRNA export from the nucleus. This protein regulates expression of Mad2 mitotic arrest deficient-like 1, a cell division checkpoint protein. This pro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028162	hsa-miR-93-5p	Sequencing	20371350
MIRT1217733	hsa-miR-1283	CLIP-seq
MIRT1217734	hsa-miR-3133	CLIP-seq
MIRT1217735	hsa-miR-3185	CLIP-seq
MIRT1217736	hsa-miR-4511	CLIP-seq
MIRT1217737	hsa-miR-4659a-5p	CLIP-seq
MIRT1217738	hsa-miR-4659b-5p	CLIP-seq
MIRT1217739	hsa-miR-520d-5p	CLIP-seq
MIRT1217740	hsa-miR-524-5p	CLIP-seq
MIRT1217741	hsa-miR-568	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000973	Process	Post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery	IBA
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	22343721, 23591820, 25416956, 32296183, 35271311
GO:0005634	Component	Nucleus	IDA	23591820
GO:0005634	Component	Nucleus	IEA
GO:0005643	Component	Nuclear pore	IEA
GO:0005737	Component	Cytoplasm	IDA	23591820
GO:0005737	Component	Cytoplasm	IEA
GO:0006368	Process	Transcription elongation by RNA polymerase II	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016973	Process	Poly(A)+ mRNA export from nucleus	IBA
GO:0016973	Process	Poly(A)+ mRNA export from nucleus	IMP	20870947
GO:0032991	Component	Protein-containing complex	IEA
GO:0044615	Component	Nuclear pore nuclear basket	IDA	23591820
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IEA
GO:0045814	Process	Negative regulation of gene expression, epigenetic	ISS
GO:0048536	Process	Spleen development	IEA
GO:0048536	Process	Spleen development	ISS
GO:0051028	Process	MRNA transport	IEA
GO:0070390	Component	Transcription export complex 2	IBA
GO:0070390	Component	Transcription export complex 2	IDA	23591820
GO:1905457	Process	Negative regulation of lymphoid progenitor cell differentiation	IEA
GO:1905457	Process	Negative regulation of lymphoid progenitor cell differentiation	ISS

Other IDs

• MIM: 613713
• HGNC: 25653
• e!Ensembl: ENSG00000126226

Protein

• UniProt ID: Q5JVF3
• Protein name: PCI domain-containing protein 2 (CSN12-like protein)
• Protein function: Required for B-cell survival through the regulation of the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation (By similarity). As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm t
• PDB: 3T5X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01399	PCI	277 → 388	PCI domain	Domain

• Sequence:

  MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDE
  MFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFAN
  NADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYF
  KINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHC
  HRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAK
  HEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEV
  QCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC

• Sequence length: 399

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	34031538	★☆☆☆☆ Found in Text Mining only