Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55790
Gene name Gene Name - the full gene name approved by the HGNC.	Chondroitin sulfate N-acetylgalactosaminyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CSGALNACT1
Synonyms (NCBI Gene) Gene synonyms aliases	CSGalNAcT-1, ChGn, ChGn-1, SDJLABA, beta4GalNAcT
Disease Acronyms (UniProt) Disease acronyms from UniProt database	SDJLABA
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an enzyme that transfers N-acetylglucosamine (GalNAc) to the core tetrasaccharide linker and to elongating chondroitin sulfate chains in proteoglycans. Knockout of the orthologous mouse gene indicates that the protein is necessary for no

Show/Hide all(100)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017694	hsa-miR-335-5p	Microarray	18185580
MIRT022557	hsa-miR-124-3p	Microarray	18668037
MIRT051118	hsa-miR-16-5p	CLASH	23622248
MIRT045696	hsa-miR-126-5p	CLASH	23622248
MIRT720894	hsa-miR-10a-5p	HITS-CLIP	19536157
MIRT720893	hsa-miR-10b-5p	HITS-CLIP	19536157
MIRT720892	hsa-miR-6871-3p	HITS-CLIP	19536157
MIRT720891	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT720890	hsa-miR-4459	HITS-CLIP	19536157
MIRT720889	hsa-miR-665	HITS-CLIP	19536157
MIRT720888	hsa-miR-4786-3p	HITS-CLIP	19536157
MIRT720887	hsa-miR-3663-3p	HITS-CLIP	19536157
MIRT720886	hsa-miR-765	HITS-CLIP	19536157
MIRT538335	hsa-miR-199b-5p	PAR-CLIP	22012620
MIRT538334	hsa-miR-199a-5p	PAR-CLIP	22012620
MIRT538333	hsa-miR-4255	PAR-CLIP	22012620
MIRT538332	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT538331	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT538330	hsa-miR-1825	PAR-CLIP	22012620
MIRT538329	hsa-miR-3925-3p	PAR-CLIP	22012620
MIRT538328	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT538327	hsa-miR-616-3p	PAR-CLIP	22012620
MIRT538326	hsa-miR-124-5p	PAR-CLIP	22012620
MIRT538325	hsa-miR-4691-5p	PAR-CLIP	22012620
MIRT538324	hsa-miR-6792-3p	PAR-CLIP	22012620
MIRT538323	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT538322	hsa-miR-670-3p	PAR-CLIP	22012620
MIRT538321	hsa-miR-1238-3p	PAR-CLIP	22012620
MIRT720894	hsa-miR-10a-5p	HITS-CLIP	19536157
MIRT720893	hsa-miR-10b-5p	HITS-CLIP	19536157
MIRT720892	hsa-miR-6871-3p	HITS-CLIP	19536157
MIRT720891	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT720890	hsa-miR-4459	HITS-CLIP	19536157
MIRT720889	hsa-miR-665	HITS-CLIP	19536157
MIRT720888	hsa-miR-4786-3p	HITS-CLIP	19536157
MIRT720887	hsa-miR-3663-3p	HITS-CLIP	19536157
MIRT720886	hsa-miR-765	HITS-CLIP	19536157
MIRT538335	hsa-miR-199b-5p	PAR-CLIP	22012620
MIRT538334	hsa-miR-199a-5p	PAR-CLIP	22012620
MIRT538333	hsa-miR-4255	PAR-CLIP	22012620
MIRT538332	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT538331	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT538330	hsa-miR-1825	PAR-CLIP	22012620
MIRT538329	hsa-miR-3925-3p	PAR-CLIP	22012620
MIRT538328	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT538327	hsa-miR-616-3p	PAR-CLIP	22012620
MIRT538326	hsa-miR-124-5p	PAR-CLIP	22012620
MIRT538325	hsa-miR-4691-5p	PAR-CLIP	22012620
MIRT538324	hsa-miR-6792-3p	PAR-CLIP	22012620
MIRT538323	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT538322	hsa-miR-670-3p	PAR-CLIP	22012620
MIRT538321	hsa-miR-1238-3p	PAR-CLIP	22012620
MIRT911818	hsa-miR-1273g	CLIP-seq
MIRT911819	hsa-miR-3150b-3p	CLIP-seq
MIRT911820	hsa-miR-338-5p	CLIP-seq
MIRT911821	hsa-miR-3682-5p	CLIP-seq
MIRT911822	hsa-miR-4303	CLIP-seq
MIRT911823	hsa-miR-4649-3p	CLIP-seq
MIRT911824	hsa-miR-4689	CLIP-seq
MIRT911825	hsa-miR-4784	CLIP-seq
MIRT911826	hsa-miR-513b	CLIP-seq
MIRT2386500	hsa-miR-1261	CLIP-seq
MIRT2386501	hsa-miR-3165	CLIP-seq
MIRT2386502	hsa-miR-342-5p	CLIP-seq
MIRT2386503	hsa-miR-4651	CLIP-seq
MIRT2386504	hsa-miR-4664-5p	CLIP-seq
MIRT2386505	hsa-miR-548ae	CLIP-seq
MIRT2386506	hsa-miR-548aj	CLIP-seq
MIRT2386507	hsa-miR-548am	CLIP-seq
MIRT2386508	hsa-miR-548p	CLIP-seq
MIRT2386509	hsa-miR-548x	CLIP-seq
MIRT2386510	hsa-miR-608	CLIP-seq
MIRT2386500	hsa-miR-1261	CLIP-seq
MIRT2509525	hsa-miR-1271	CLIP-seq
MIRT2509526	hsa-miR-182	CLIP-seq
MIRT2509527	hsa-miR-183	CLIP-seq
MIRT2509528	hsa-miR-3189-3p	CLIP-seq
MIRT2509529	hsa-miR-3201	CLIP-seq
MIRT2509530	hsa-miR-3545-3p	CLIP-seq
MIRT2509531	hsa-miR-3622b-5p	CLIP-seq
MIRT2509532	hsa-miR-371-5p	CLIP-seq
MIRT2509533	hsa-miR-371b-5p	CLIP-seq
MIRT2509534	hsa-miR-3973	CLIP-seq
MIRT2509535	hsa-miR-4310	CLIP-seq
MIRT2509536	hsa-miR-450b-5p	CLIP-seq
MIRT2509537	hsa-miR-4642	CLIP-seq
MIRT2509538	hsa-miR-4742-5p	CLIP-seq
MIRT2509539	hsa-miR-4766-5p	CLIP-seq
MIRT2509540	hsa-miR-4778-3p	CLIP-seq
MIRT2509541	hsa-miR-4791	CLIP-seq
MIRT2509542	hsa-miR-507	CLIP-seq
MIRT2509543	hsa-miR-520g	CLIP-seq
MIRT2509544	hsa-miR-520h	CLIP-seq
MIRT2509545	hsa-miR-548l	CLIP-seq
MIRT2509546	hsa-miR-557	CLIP-seq
MIRT2509547	hsa-miR-96	CLIP-seq
MIRT2509536	hsa-miR-450b-5p	CLIP-seq
MIRT2509538	hsa-miR-4742-5p	CLIP-seq
MIRT2509542	hsa-miR-507	CLIP-seq
MIRT2509546	hsa-miR-557	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001958	Process	Endochondral ossification	IEA
GO:0008376	Function	Acetylgalactosaminyltransferase activity	IBA	21873635
GO:0008376	Function	Acetylgalactosaminyltransferase activity	IDA	11514575
GO:0008376	Function	Acetylgalactosaminyltransferase activity	ISS	11788602
GO:0008955	Function	Peptidoglycan glycosyltransferase activity	IDA	11514575
GO:0015014	Process	Heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process	NAS	11514575
GO:0015020	Function	Glucuronosyltransferase activity	IDA	11514575
GO:0019276	Process	UDP-N-acetylgalactosamine metabolic process	IDA	11514575
GO:0030166	Process	Proteoglycan biosynthetic process	ISS	11788602
GO:0030173	Component	Integral component of Golgi membrane	NAS	11514575
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030206	Process	Chondroitin sulfate biosynthetic process	IBA	21873635
GO:0030206	Process	Chondroitin sulfate biosynthetic process	IDA	11514575, 12163485
GO:0030206	Process	Chondroitin sulfate biosynthetic process	TAS
GO:0030210	Process	Heparin biosynthetic process	NAS	11514575
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0046398	Process	UDP-glucuronate metabolic process	IDA	11514575
GO:0046872	Function	Metal ion binding	NAS	12163485
GO:0047237	Function	Glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase activity	IDA	12163485
GO:0047238	Function	Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity	IBA	21873635
GO:0047238	Function	Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity	IDA	12163485
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	ISS	11788602
GO:0050651	Process	Dermatan sulfate proteoglycan biosynthetic process	ISS	11788602
GO:0050653	Process	Chondroitin sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process	IDA	12163485
GO:0051216	Process	Cartilage development	IEA

MIM	HGNC	e!Ensembl
616615	24290	ENSG00000147408

Protein

UniProt ID

Q8TDX6

Protein name

Chondroitin sulfate N-acetylgalactosaminyltransferase 1 (CsGalNAcT-1) (EC 2.4.1.174) (Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1) (Beta4GalNAcT-1)

Protein function

Transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). Required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. Important rol

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05679	CHGN	58 → 507	Chondroitin N-acetylgalactosaminyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous, with the highest levels in placenta, thyroid, bladder, prostate and adrenal gland. Detected at low levels in the other tissues examined. {ECO:0000269|PubMed:11788602, ECO:0000269|PubMed:12163485, ECO:0000269|PubMed:12446672

Sequence

MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAV
LQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADL
LAFLHSQVDKAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDEL
VEAIESALETLNSPAENSPNHRPYTASDFIEGIYRTERDKGTLYELTFKGDHKHEFKRLI
LFRPFGPIMKVKNEKLNMANTLINVIVPLAKRVDKFRQFMQNFREMCIEQDGRVHLTVVY
FGKEEINEVKGILENTSKAANFRNFTFIQLNGEFSRGKGLDVGARFWKGSNVLLFFCDVD
IYFTSEFLNTCRLNTQPGKKVFYPVLFSQYNPGIIYGHHDAVPPLEQQLVIKKETGFWRD
FGFGMTCQYRSDFINIGGFDLDIKGWGGEDVHLYRKYLHSNLIVVRTPVRGLFHLWHEKR
CMDELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT

Sequence length

532

Interactions

View interactions

	KEGG		Reactome
	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate Metabolic pathways		Chondroitin sulfate biosynthesis

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Unknown Diseases (7)

Disease term	Disease name	Source
Unknown
Skeletal Dysplasia	skeletal dysplasia, mild, with joint laxity and advanced bone age	GenCC
Metabolic Syndrome	Metabolic Syndrome	GWAS
Hyperlipidemia	Hyperlipidemia	GWAS
Dermatitis	Dermatitis	GWAS
Oligodendroglioma	Oligodendroglioma	GWAS
Dyslexia	Dyslexia	GWAS
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining
Anorexia Nervosa	Associate	35703085
Cartilage Diseases	Associate	23748413
Cataract Age Related Nuclear	Associate	34954695
Congenital Disorders of Glycosylation	Associate	31705726
Growth Disorders	Associate	31705726
HEM dysplasia	Associate	31705726
Intervertebral Disc Degeneration	Associate	30148873
Kashin Beck Disease	Inhibit	23748413
Language Development Disorders	Associate	31705726
Osteoarthritis	Associate	15176972
Osteoarthritis	Inhibit	23748413
Osteogenesis Imperfecta	Associate	32281310
Osteoporosis	Associate	15176972
Prostatitis	Associate	27428423
Pulmonary Disease Chronic Obstructive	Associate	36681830

CSGALNACT1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1)