Gene Gene information from NCBI Gene database.
Entrez ID 55781
Gene name RIO kinase 2
Gene symbol RIOK2
Synonyms (NCBI Gene)
RIO2
Chromosome 5
Chromosome location 5q15
miRNA miRNA information provided by mirtarbase database.
135
miRTarBase ID miRNA Experiments Reference
MIRT020827 hsa-miR-155-5p Proteomics 18668040
MIRT027348 hsa-miR-101-3p Sequencing 20371350
MIRT032368 hsa-let-7b-5p Proteomics 18668040
MIRT048452 hsa-miR-100-5p CLASH 23622248
MIRT047511 hsa-miR-10a-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003824 Function Catalytic activity IEA
GO:0004672 Function Protein kinase activity IBA
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617754 18999 ENSG00000058729
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BVS4
Protein name Serine/threonine-protein kinase RIO2 (EC 2.7.11.1) (RIO kinase 2)
Protein function Serine/threonine-protein kinase involved in the final steps of cytoplasmic maturation of the 40S ribosomal subunit. Involved in export of the 40S pre-ribosome particles (pre-40S) from the nucleus to the cytoplasm. Its kinase activity is required
PDB 5DHF , 6FDM , 6FDN , 6FDO , 6G18 , 6G51 , 6HK6 , 7VBT , 7WU0 , 9F81
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09202 Rio2_N 9 91 Rio2, N-terminal Domain
PF01163 RIO1 108 284 Family
Sequence
MGKVNVAKLRYMSRDDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGGCNKVLRELVKHK
LIAWERTKTVQGYRLTNAGYDYLALKTLSSR
QVVESVGNQMGVGKESDIYIVANEEGQQF
ALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPID
YNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGDFNEFNLILDESD
HITMIDFPQMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYESELF
PTFKDIRREDTLDVEV
SASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGSENESERNCLE
ESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEK
NRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEENVGAMNQYRTR
TLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNI
KSSLEAASFWGE
Sequence length 552
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Ribosome biogenesis in eukaryotes   Major pathway of rRNA processing in the nucleolus and cytosol
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Gastric cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Thymoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Amyotrophic lateral sclerosis 1 Inhibit 37838312
★☆☆☆☆
Found in Text Mining only
Carcinoma Non Small Cell Lung Associate 27346559
★☆☆☆☆
Found in Text Mining only
Glioma Associate 32125767
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Associate 27346559
★☆☆☆☆
Found in Text Mining only
Neoplasm Metastasis Associate 27346559
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 27346559, 36661680
★☆☆☆☆
Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck Associate 36661680
★☆☆☆☆
Found in Text Mining only