Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5577
Gene name Gene Name - the full gene name approved by the HGNC.
Protein kinase cAMP-dependent type II regulatory subunit beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRKAR2B
Synonyms (NCBI Gene) Gene synonyms aliases
PRKAR2, RII-BETA
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holo
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016228 hsa-miR-590-3p Sequencing 20371350
MIRT1262833 hsa-miR-1272 CLIP-seq
MIRT1262834 hsa-miR-1305 CLIP-seq
MIRT1262835 hsa-miR-150 CLIP-seq
MIRT1262836 hsa-miR-188-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004862 Function CAMP-dependent protein kinase inhibitor activity IBA
GO:0004862 Function CAMP-dependent protein kinase inhibitor activity IDA 21812984
GO:0004862 Function CAMP-dependent protein kinase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 17148597, 20007971, 23455922, 24605759, 25477193, 25920809, 26496610, 26871637, 27107012, 28514442, 32296183, 32707033, 33058759, 33961781, 35271311
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
176912 9392 ENSG00000005249
Protein
UniProt ID P31323
Protein name cAMP-dependent protein kinase type II-beta regulatory subunit
Protein function Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02197 RIIa 7 44 Regulatory subunit of type II PKA R-subunit Domain
PF00027 cNMP_binding 172 259 Cyclic nucleotide-binding domain Domain
PF00027 cNMP_binding 294 387 Cyclic nucleotide-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
Sequence
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
LGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY
NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH
VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS
PGALWGLDRVTFRRIIVKN
NAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG
EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP
RAASAHAIGTVKCLAMDVQAFERLLGP
CMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Sequence length 418
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Insulin signaling pathway   PKA activation
PKA activation in glucagon signalling
DARPP-32 events
Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Vasopressin regulates renal water homeostasis via Aquaporins
CREB1 phosphorylation through the activation of Adenylate Cyclase
Hedgehog 'off' state
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
ADORA2B mediated anti-inflammatory cytokines production
FCGR3A-mediated IL10 synthesis
Factors involved in megakaryocyte development and platelet production
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes, Triglyceride levels in non-type 2 diabetes N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 25268545
Aneuploidy Associate 18056771
Breast Neoplasms Associate 26336805
Carcinoma Stimulate 25393625
Congenital chloride diarrhea Associate 8963897
Hypertension Associate 32888289
Hypoxia Inhibit 32111982
Lupus Erythematosus Systemic Associate 10946316
Lymphoma Associate 18544528, 37569769
Neoplasms Associate 1689049, 2000408, 33960436