Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55750
Gene name Gene Name - the full gene name approved by the HGNC.
Acylglycerol kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AGK
Synonyms (NCBI Gene) Gene synonyms aliases
CATC5, CTRCT38, MTDPS10, MULK
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q34
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a mitochondrial membrane protein involved in lipid and glycerolipid metabolism. The encoded protein is a lipid kinase that catalyzes the formation of phosphatidic and lysophosphatidic acids. Defects in this gene have be
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs35269563 A>G Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs142069429 C>T Conflicting-interpretations-of-pathogenicity, uncertain-significance Genic downstream transcript variant, coding sequence variant, missense variant
rs387907024 C>T Pathogenic Coding sequence variant, stop gained
rs387907025 C>T Pathogenic Coding sequence variant, stop gained
rs542547163 G>A Pathogenic Genic downstream transcript variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025890 hsa-miR-7-5p Microarray 19073608
MIRT031554 hsa-miR-16-5p Proteomics 18668040
MIRT043923 hsa-miR-378a-3p CLASH 23622248
MIRT042001 hsa-miR-484 CLASH 23622248
MIRT529306 hsa-miR-3691-3p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001727 Function Lipid kinase activity IEA
GO:0001729 Function Ceramide kinase activity IBA
GO:0001729 Function Ceramide kinase activity IEA
GO:0004143 Function ATP-dependent diacylglycerol kinase activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610345 21869 ENSG00000006530
Protein
UniProt ID Q53H12
Protein name Acylglycerol kinase, mitochondrial (hAGK) (EC 2.7.1.107) (EC 2.7.1.138) (EC 2.7.1.94) (Multiple substrate lipid kinase) (HsMuLK) (MuLK) (Multi-substrate lipid kinase)
Protein function Lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively (PubMed:15939762). Does not phosphorylate sphingosine (PubMed:15939762). Phosphorylates cer
PDB 7CGP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00781 DAGK_cat 62 195 Diacylglycerol kinase catalytic domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in muscle, heart, kidney and brain. {ECO:0000269|PubMed:15939762}.
Sequence
MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPPNAQV
KKATVFLNPAACKGKARTLFEKNAAPILHLSGMDVTIVKTDYEGQAKKLLELMENTDVII
VAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGETSSLSHTLFAESGNKVQHITDATL
AIVKGETVPLDVLQI
KGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFST
LKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSP
EVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGSRKVRNPKLHV
EGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSP
TQ
Sequence length 422
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycerolipid metabolism
Metabolic pathways
  Glycerophospholipid biosynthesis
Signaling by BRAF and RAF fusions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
sengers syndrome Sengers syndrome rs1554399572, rs863223895, rs1554405935, rs777096695, rs868431923, rs1554401640, rs387907024, rs1554405947, rs1554401641, rs1587181981, rs387907025, rs1587053244, rs771945804, rs1587162871, rs542547163
View all (3 more)
N/A
Trichohepatoenteric Syndrome trichohepatoenteric syndrome 1 rs746709222 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cataract Developmental cataract, total early-onset cataract, cataract 38 N/A N/A ClinVar, GenCC
Mitochondrial Diseases mitochondrial disease N/A N/A GenCC
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Lactic Associate 28712726, 33476211, 36253788
Adenocarcinoma of Lung Associate 31747139
Carcinoma Ovarian Epithelial Stimulate 35934718
Carcinoma Renal Cell Associate 31900208, 37009826
Cardiomyopathies Associate 22284826, 34948281
Cardiomyopathy Hypertrophic Associate 28712724, 28712726, 33120694, 33476211
Cataract Associate 22284826, 28712724, 28712726, 33120694, 33476211, 34948281, 36253788
Cataract and cardiomyopathy Associate 22284826, 28712724, 28712726, 33120694, 33476211, 34948281, 36253788, 39824030
Death Associate 34948281
Dilatation Pathologic Associate 34948281