CCAR1 (cell division cycle and apoptosis regulator 1)

Gene

• Entrez ID: 55749
• Gene name: Cell division cycle and apoptosis regulator 1
• Gene symbol: CCAR1
• Synonyms (NCBI Gene): uc.285+
• Chromosome: 10
• Chromosome location: 10q21.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030489	hsa-miR-24-3p	Microarray	19748357
MIRT049109	hsa-miR-92a-3p	CLASH	23622248
MIRT045240	hsa-miR-186-5p	CLASH	23622248
MIRT737269	hsa-miR-627-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32945522
MIRT1957361	hsa-miR-323-3p	CLIP-seq
MIRT1957362	hsa-miR-3591-3p	CLIP-seq
MIRT1957363	hsa-miR-656	CLIP-seq
MIRT2497695	hsa-miR-181a	CLIP-seq
MIRT2497696	hsa-miR-181b	CLIP-seq
MIRT2497697	hsa-miR-181c	CLIP-seq
MIRT2497698	hsa-miR-181d	CLIP-seq
MIRT2497699	hsa-miR-23a	CLIP-seq
MIRT2497700	hsa-miR-23b	CLIP-seq
MIRT2497701	hsa-miR-23c	CLIP-seq
MIRT2497702	hsa-miR-2681	CLIP-seq
MIRT2497703	hsa-miR-3074-3p	CLIP-seq
MIRT2497704	hsa-miR-3545-3p	CLIP-seq
MIRT2497705	hsa-miR-4262	CLIP-seq
MIRT2497706	hsa-miR-433	CLIP-seq
MIRT2497707	hsa-miR-4668-3p	CLIP-seq
MIRT2497708	hsa-miR-4711-5p	CLIP-seq
MIRT2497709	hsa-miR-4729	CLIP-seq
MIRT2497710	hsa-miR-4789-5p	CLIP-seq
MIRT2497711	hsa-miR-499-3p	CLIP-seq
MIRT2497712	hsa-miR-499a-3p	CLIP-seq
MIRT2497713	hsa-miR-543	CLIP-seq
MIRT2497714	hsa-miR-548a-3p	CLIP-seq
MIRT2497715	hsa-miR-548e	CLIP-seq
MIRT2497716	hsa-miR-548f	CLIP-seq
MIRT2497717	hsa-miR-579	CLIP-seq
MIRT2497695	hsa-miR-181a	CLIP-seq
MIRT2497696	hsa-miR-181b	CLIP-seq
MIRT2497697	hsa-miR-181c	CLIP-seq
MIRT2497698	hsa-miR-181d	CLIP-seq
MIRT2497699	hsa-miR-23a	CLIP-seq
MIRT2497700	hsa-miR-23b	CLIP-seq
MIRT2497701	hsa-miR-23c	CLIP-seq
MIRT2497704	hsa-miR-3545-3p	CLIP-seq
MIRT2497705	hsa-miR-4262	CLIP-seq
MIRT2497709	hsa-miR-4729	CLIP-seq
MIRT2497710	hsa-miR-4789-5p	CLIP-seq
MIRT2497711	hsa-miR-499-3p	CLIP-seq
MIRT2497712	hsa-miR-499a-3p	CLIP-seq
MIRT2497714	hsa-miR-548a-3p	CLIP-seq
MIRT2497715	hsa-miR-548e	CLIP-seq
MIRT2497716	hsa-miR-548f	CLIP-seq
MIRT2497717	hsa-miR-579	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	TAS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	24245781
GO:0003713	Function	Transcription coactivator activity	IDA	24245781
GO:0003713	Function	Transcription coactivator activity	IMP	23887938
GO:0003714	Function	Transcription corepressor activity	IMP	23887938
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	18157088, 20594350, 23887938, 24245781, 25416956, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005641	Component	Nuclear envelope lumen	IDA	12816952
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0006915	Process	Apoptotic process	IEA
GO:0007049	Process	Cell cycle	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	23887938
GO:0030335	Process	Positive regulation of cell migration	IMP	23887938
GO:0030374	Function	Nuclear receptor coactivator activity	IBA	21873635
GO:0030374	Function	Nuclear receptor coactivator activity	IGI	18722177
GO:0043065	Process	Positive regulation of apoptotic process	IDA	12816952
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA

Other IDs

• MIM: 612569
• HGNC: 24236
• e!Ensembl: ENSG00000060339

Protein

• UniProt ID: Q8IX12
• Protein name: Cell division cycle and apoptosis regulator protein 1 (Cell cycle and apoptosis regulatory protein 1) (CARP-1) (Death inducer with SAP domain)
• Protein function: Associates with components of the Mediator and p160 coactivator complexes that play a role as intermediaries transducing regulatory signals from upstream transcriptional activator proteins to basal transcription machinery at the core promoter. R
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14444	S1-like	147 → 204	S1-like	Domain
  PF14443	DBC1	479 → 604	DBC1	Domain
  PF02037	SAP	636 → 670	SAP domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in various epithelial cancer cell lines, including breast, colon, prostate, pancreatic and leukemia. Expression is regulated by growth factors. {ECO:0000269|PubMed:12816952}.
• Sequence:

  MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPAN
  YQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLS
  TPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTP
  QVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPPAVLQPIAPQTTFGVQT
  QPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQPPVRIVSQPQPARRLDPPSR
  FSGRNDRGDQVPNRKDDRSRERERERRRSRERSPQRKRSRERSPRRERERSPRRVRRVVP
  RYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFY
  VMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQH
  PARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCT
  QWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEK
  LQGERKEADGEQDEEEKDDGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKS
  QLIARLTKQLKVEEQKEEQKELEKSEKEEDEDDDRKSEDDKEEEERKRQEEIERQRRERR
  YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQR
  DFGVRIYKSLLSLPEKEDKKEKDKKSKKDERKDKKEERDDETDEPKPKRRKSGDDKDKKE
  DRDERKKEDKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDIN
  RYCKERPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQ
  VKKLLNKVVLRESCFYRKLTDTSKDEENHEESESLQEDMLGNRLLLPTPTVKQESKDVEE
  NVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLS
  GELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNEDKD
  QKSKENGASV

• Sequence length: 1150

Pathways

Reactome:

mRNA Splicing - Major Pathway

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800, rs63750198, rs63751109, rs863223312, rs63750710, rs63751615, rs63750206, rs63750781, rs63750899, rs63750691, rs63750217, rs121912965, rs63749939, rs63751194, rs63750693, rs63750540, rs63751221, rs193922370, rs80359596, rs397514632, rs483352909, rs200495564, rs397514684, rs397516436, rs398122386, rs79512956, rs74953290, rs587779001, rs63750677, rs63749837, rs267607816, rs63751715, rs267607819, rs267607815, rs267607822, rs63749906, rs587778883, rs63750472, rs63751012, rs63750715, rs63750580, rs267607706, rs267607709, rs267607710, rs587778894, rs63750749, rs63750483, rs63751015, rs63751153, rs63751094, rs63751118, rs63750316, rs63749981, rs587778906, rs267607821, rs587778908, rs63750020, rs587778909, rs63750713, rs267607825, rs63751592, rs281864936, rs587778913, rs587778914, rs63749795, rs63750855, rs63749916, rs63749923, rs63751472, rs63751689, rs267607832, rs267607837, rs267607836, rs587778923, rs63750028, rs587778928, rs587778929, rs587778930, rs63751277, rs587778933, rs267607842, rs267607843, rs63750192, rs587778934, rs63750193, rs587778937, rs587778938, rs267607845, rs63751244, rs63751393, rs63751460, rs267607849, rs267607853, rs267607856, rs267607850, rs63751657, rs267607854, rs267607852, rs587778942, rs63750309, rs63750587, rs63749863, rs63751486, rs63750016, rs63749868, rs63750375, rs63750035, rs63750604, rs63750386, rs63750150, rs63750486, rs63751428, rs267607866, rs63749986, rs63751594, rs63750152, rs63750850, rs267607867, rs267607868, rs63751632, rs267607871, rs63751892, rs587778956, rs63750469, rs587778958, rs63749792, rs267607875, rs63751255, rs281864938, rs63751202, rs63750726, rs63751310, rs63749900, rs587778964, rs267607879, rs267607878, rs587778966, rs267607883, rs267607887, rs63750061, rs63750663, rs587778968, rs587778971, rs63750809, rs63749867, rs63750864, rs587778972, rs63751275, rs267607718, rs267607722, rs63750769, rs267607717, rs587778973, rs267607716, rs267607720, rs63749995, rs63750859, rs587778975, rs63750114, rs587778976, rs63750603, rs267607889, rs267607723, rs63750561, rs63750499, rs63751642, rs63751022, rs587778981, rs63750971, rs267607898, rs267607906, rs267607903, rs587778989, rs587778992, rs267607894, rs267607901, rs267607892, rs63750437, rs587778997, rs587778998, rs63750005, rs63750641, rs63751421, rs11541859, rs63750266, rs111052004, rs267607726, rs267607727, rs63750453, rs267607734, rs267607735, rs63751665, rs267607736, rs267607732, rs63749816, rs63750539, rs267607739, rs587779006, rs587779008, rs267607745, rs267607742, rs63751595, rs267607743, rs587779010, rs587779012, rs63750057, rs63749818, rs63751124, rs587779014, rs587779015, rs63749820, rs63751302, rs267607750, rs267607751, rs267607749, rs63750891, rs63749959, rs63749804, rs267607765, rs267607760, rs587779021, rs267607759, rs63750515, rs587779023, rs63751021, rs63751480, rs267607772, rs267607773, rs587779024, rs63751653, rs587779027, rs267607767, rs587779029, rs63750706, rs63750385, rs267607774, rs267607778, rs267607780, rs587779034, rs63751711, rs267607784, rs587779035, rs63750823, rs63750822, rs267607787, rs63750303, rs63749839, rs63749827, rs267607789, rs267607790, rs267607791, rs267607786, rs267607771, rs267607795, rs267607794, rs267607788, rs267607799, rs267607801, rs587779045, rs63750034, rs587779047, rs63750216, rs63751707, rs63751598, rs267607803, rs267607777, rs63750144, rs267607805, rs63750547, rs63750489, rs63750993, rs587779054, rs63751259, rs63749926, rs63750796, rs587779058, rs63750745, rs63750582, rs180177084, rs587779866, rs200389141, rs587779950, rs587780104, rs587780183, rs587778536, rs587780683, rs587781554, rs267607712, rs587777627, rs587783057, rs730881734, rs41542214, rs730881273, rs786203456, rs786201990, rs786202767, rs748005072, rs786204317, rs786204318, rs797045117, rs63750549, rs863225383, rs863225384, rs863225373, rs863225376, rs863225377, rs863225378, rs863225379, rs863225380, rs863225381, rs63750059, rs267607823, rs864622457, rs869312767, rs869312753, rs876661059, rs876658915, rs876658923, rs876660860, rs876660822, rs876660458, rs876660214, rs876658657, rs876658247, rs876659226, rs876658821, rs876660589, rs876659068, rs876659681, rs876659608, rs878853794, rs878853778, rs878853780, rs878853785, rs886039423, rs886039424, rs1057517543, rs1057517541, rs756843954, rs1057517617, rs1057517558, rs1057519256, rs1060500689, rs764085979, rs1060500707, rs1060500699, rs1060500706, rs1060500703, rs1064795341, rs1064793607, rs1064794348, rs1064795441, rs1064794373, rs1064793172, rs1064794122, rs1064795515, rs1064794331, rs63750978, rs1114167435, rs1553641362, rs63751448, rs1553648029, rs1553648058, rs587778903, rs1553653237, rs1553664353, rs267607744, rs1553647995, rs1553648047, rs1553653084, rs1553663750, rs1553664436, rs1553488015, rs1553637293, rs63750310, rs63750443, rs63751596, rs1553646681, rs550890395, rs1064796057, rs1553642079, rs1553648023, rs587782087, rs746536721, rs1553653037, rs1248251121, rs1553646602, rs1434898623, rs1553665683, rs1553648068, rs1553645331, rs1553644123, rs1553658246, rs1553651299, rs1553648149, rs1553663159, rs1302248679, rs1553664119, rs1553658009, rs1553665977, rs1416171624, rs1553663834, rs1553664617, rs1553664702, rs1553647969, rs1553648040, rs1437454428, rs1553641273, rs63751101, rs1553646764, rs1553648225, rs1554082118, rs1553648201, rs1553638868, rs1553665866, rs376736188, rs1553642707, rs1553645226, rs1553652883, rs63751435, rs1553653115, rs1553653195, rs63750300, rs1553662622, rs1553658104, rs1553648220, rs1559544064, rs63750584, rs267608083, rs1559551570, rs1559575107, rs1559553501, rs1565986506, rs1559524405, rs1559553492, rs1559554339, rs1559588540, rs1559558071, rs761329565, rs1559521039, rs1559574795, rs1567221417, rs1559578422, rs1481129490, rs1570714352, rs779783209, rs1575376830, rs1575469070, rs1575537843, rs1575620443, rs1575621506, rs587779022, rs1575414904, rs1575449093, rs1575469505, rs1575536254, rs1575537933, rs1575632112, rs1575639851, rs1575441094, rs1575449402, rs267607831, rs2081922847, rs2083403132, rs2085415927, rs2085469647, rs2043913790, rs147542208

Associations from Text Mining
Disease Name	Relationship Type	References
Azoospermia Nonobstructive	Associate	38403804
Breast Neoplasms	Associate	21596782
Carcinoma Hepatocellular	Associate	26511806
Colonic Neoplasms	Associate	19520846
Colorectal Neoplasms	Associate	19520846
Neoplasm Metastasis	Stimulate	26511806
Neoplasms	Associate	19520846, 36418423
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	23975424
Prostatic Neoplasms	Associate	23887938
Prostatitis	Associate	23887938
Thyroid Cancer Papillary	Associate	37917782