Gene Gene information from NCBI Gene database.
Entrez ID 55746
Gene name Nucleoporin 133
Gene symbol NUP133
Synonyms (NCBI Gene)
GAMOS8NPHS18hNUP133
Chromosome 1
Chromosome location 1q42.13
Summary The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules
SNPs SNP information provided by dbSNP.
4
SNP ID Visualize variation Clinical significance Consequence
rs376476266 A>G Likely-pathogenic Coding sequence variant, missense variant, non coding transcript variant
rs1433513056 A>G,T Pathogenic Intron variant
rs1558091788 A>C Likely-pathogenic Coding sequence variant, missense variant, non coding transcript variant
rs1558108130 G>C Likely-pathogenic Coding sequence variant, missense variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
163
miRTarBase ID miRNA Experiments Reference
MIRT035996 hsa-miR-1301-3p CLASH 23622248
MIRT461348 hsa-miR-590-3p PAR-CLIP 23592263
MIRT461347 hsa-miR-3120-3p PAR-CLIP 23592263
MIRT461346 hsa-miR-3126-3p PAR-CLIP 23592263
MIRT461345 hsa-miR-1298-3p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IDA 17098863
GO:0000776 Component Kinetochore IEA
GO:0000972 Process Transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery IBA
GO:0005515 Function Protein binding IPI 11564755, 15146057, 17363900, 24315095, 24725412, 24947832, 26411495, 26496610, 27194810, 30179222, 31046837, 33961781, 34819669, 35271311
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607613 18016 ENSG00000069248
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WUM0
Protein name Nuclear pore complex protein Nup133 (133 kDa nucleoporin) (Nucleoporin Nup133)
Protein function Involved in poly(A)+ RNA transport. Involved in nephrogenesis (PubMed:30179222).
PDB 1XKS , 3CQC , 3CQG , 3I4R , 5A9Q , 7PEQ , 7R5J , 7R5K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03177 Nucleoporin_C 594 1024 Non-repetitive/WGA-negative nucleoporin C-terminal Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed in fetal and adult tissues. Expressed in the brain and kidney. {ECO:0000269|PubMed:30427554}.
Sequence
MFPAAPSPRTPGTGSRRGPLAGLGPGSTPRTASRKGLPLGSAVSSPVLFSPVGRRSSLSS
RGTPTRMFPHHSITESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCK
EKLIIWKIALSPITKLSVCKELQLPPSDFHWSADLVALSYSSPSGEAHSTQAVAVMVATR
EGSIRYWPSLAGEDTYTEAFVDSGGDKTYSFLTAVQGGSFILSSSGSQLIRLIPESSGKI
HQHILPQGQGMLSGIGRKVSSLFGILSPSSDLTLSSVLWDRERSSFYSLTSSNISKWELD
DSSEKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCDGLVILAAAWH
SADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLY
NESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRENVS
ILAEDLEGSLASSVAGPNSESMIFETTTKNETIAQEDKIKLLKAAFLQYCRKDLGHAQMV
VDELFSSHSDLDSDSELDRAVTQISVDLMDDYPASDPRWAESVPEEAPGFSNTSLIILHQ
LEDKMKAHSFLMDFIHQVGLFGRLGSFPVRGTPMATRLLLCEHAEKLSAAIVLKNHHSRL
SDLVNTAILIALNKREYEIPSNLTPADVFFREVSQVDTICECLLEHEEQVLRDAPMDSIE
WAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEKEPEYVPWTATSGPGGIRTVIIR
QHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYL
QKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDF
LFRWYLEKGKRGKLLSQPISQHGQLANFLQAHEHLSWLHEINSQELEKAHATLLGLANME
TRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNL
SAMP
VLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDEEEDININDLKLEILCKALQR
DNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYF
EFVLKANYEYYVQGQI
Sequence length 1156
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Nucleocytoplasmic transport
Amyotrophic lateral sclerosis
  ISG15 antiviral mechanism
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Transport of the SLBP independent Mature mRNA
Transport of the SLBP Dependant Mature mRNA
Transport of Mature mRNA Derived from an Intronless Transcript
Transport of Mature mRNA derived from an Intron-Containing Transcript
Rev-mediated nuclear export of HIV RNA
Transport of Ribonucleoproteins into the Host Nucleus
NS1 Mediated Effects on Host Pathways
Viral Messenger RNA Synthesis
NEP/NS2 Interacts with the Cellular Export Machinery
Regulation of Glucokinase by Glucokinase Regulatory Protein
Vpr-mediated nuclear import of PICs
snRNP Assembly
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
SUMOylation of DNA damage response and repair proteins
SUMOylation of ubiquitinylation proteins
Nuclear Pore Complex (NPC) Disassembly
Regulation of HSF1-mediated heat shock response
SUMOylation of SUMOylation proteins
SUMOylation of chromatin organization proteins
SUMOylation of RNA binding proteins
SUMOylation of DNA replication proteins
Transcriptional regulation by small RNAs
Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
RHO GTPases Activate Formins
tRNA processing in the nucleus
Mitotic Prometaphase
HCMV Early Events
HCMV Late Events
Postmitotic nuclear pore complex (NPC) reformation
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
68
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Galloway-Mowat syndrome 8 Pathogenic; Likely pathogenic rs1433513056, rs1660478193 RCV000760137
RCV001291775
Nephrotic syndrome, type 18 Likely pathogenic rs760521214, rs1558108130, rs1558091788 RCV001808225
RCV000721158
RCV000721160
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs16849788 RCV005921264
Chronic lymphocytic leukemia/small lymphocytic lymphoma Benign rs16849788 RCV005921270
Clear cell carcinoma of kidney Benign; Likely benign rs202080887 RCV005925765
Colon adenocarcinoma Likely benign rs147969588 RCV005926633
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Brain Diseases Associate 36755238
Death Sudden Associate 25602437
Glomerulosclerosis Focal Segmental Associate 37565816
Microcephaly Associate 36755238
Nephrotic Syndrome Associate 35455939
Niemann Pick Disease Type C Associate 25602437