Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55744
Gene name	Cytochrome c oxidase assembly factor 1
Gene symbol	COA1
Synonyms (NCBI Gene)	C7orf44MITRAC15
Chromosome	7
Chromosome location	7p13

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027798	hsa-miR-98-5p	Microarray	19088304
MIRT050833	hsa-miR-17-5p	CLASH	23622248
MIRT560180	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT560179	hsa-miR-3125	PAR-CLIP	20371350
MIRT560178	hsa-miR-3916	PAR-CLIP	20371350
MIRT560177	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT560176	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT560175	hsa-miR-6077	PAR-CLIP	20371350
MIRT560174	hsa-miR-3153	PAR-CLIP	20371350
MIRT560173	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT560172	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT441035	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441035	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT560180	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT560179	hsa-miR-3125	PAR-CLIP	20371350
MIRT560178	hsa-miR-3916	PAR-CLIP	20371350
MIRT560177	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT560176	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT560175	hsa-miR-6077	PAR-CLIP	20371350
MIRT560174	hsa-miR-3153	PAR-CLIP	20371350
MIRT560173	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT560172	hsa-miR-6739-5p	PAR-CLIP	20371350

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32320651
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IDA	23260140
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	32320651
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005829	Component	Cytosol	IDA
GO:0016020	Component	Membrane	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IBA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	23260140, 32320651
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	NAS	32320651
GO:0033617	Process	Mitochondrial cytochrome c oxidase assembly	IBA
GO:0033617	Process	Mitochondrial cytochrome c oxidase assembly	IMP	23260140

MIM	HGNC	e!Ensembl
614769	21868	ENSG00000106603

Q9GZY4

Protein name

Cytochrome c oxidase assembly factor 1 homolog (Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 15 kDa)

Protein function

Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded compo

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08695	Coa1	18 → 134	Cytochrome oxidase complex assembly protein 1	Family

Sequence

MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEA
QEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEV
FLELKDGQQIPVFKLSGENGDEVKKE

Sequence length

146

Interactions

View interactions

	KEGG
	Thermogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PATELLAR TENDINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Colorectal Neoplasms	Associate	24277698	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24277698	★★★★★ ★☆☆☆☆ Found in Text Mining only

COA1 (cytochrome c oxidase assembly factor 1)