CHFR (checkpoint with forkhead and ring finger domains)

Gene

• Entrez ID: 55743
• Gene name: Checkpoint with forkhead and ring finger domains
• Gene symbol: CHFR
• Synonyms (NCBI Gene): RNF116, RNF196
• Chromosome: 12
• Chromosome location: 12q24.33
• Summary: This gene encodes an E3 ubiquitin-protein ligase required for the maintenance of the antephase checkpoint that regulates cell cycle entry into mitosis and, therefore, may play a key role in cell cycle progression and tumorigenesis. The encoded protein has

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030587	hsa-miR-24-3p	Microarray	19748357
MIRT047652	hsa-miR-10a-5p	CLASH	23622248
MIRT889812	hsa-miR-1183	CLIP-seq
MIRT889813	hsa-miR-1200	CLIP-seq
MIRT889814	hsa-miR-1253	CLIP-seq
MIRT889815	hsa-miR-1297	CLIP-seq
MIRT889816	hsa-miR-26a	CLIP-seq
MIRT889817	hsa-miR-26b	CLIP-seq
MIRT889818	hsa-miR-3185	CLIP-seq
MIRT889819	hsa-miR-3613-3p	CLIP-seq
MIRT889820	hsa-miR-4251	CLIP-seq
MIRT889821	hsa-miR-4282	CLIP-seq
MIRT889822	hsa-miR-4324	CLIP-seq
MIRT889823	hsa-miR-4465	CLIP-seq
MIRT889824	hsa-miR-4698	CLIP-seq
MIRT889825	hsa-miR-4703-3p	CLIP-seq
MIRT889826	hsa-miR-498	CLIP-seq
MIRT889827	hsa-miR-499a-5p	CLIP-seq
MIRT889828	hsa-miR-513a-3p	CLIP-seq
MIRT889829	hsa-miR-544b	CLIP-seq
MIRT889830	hsa-miR-548c-3p	CLIP-seq
MIRT889831	hsa-miR-548p	CLIP-seq
MIRT889832	hsa-miR-1226	CLIP-seq
MIRT889833	hsa-miR-1245b-3p	CLIP-seq
MIRT889815	hsa-miR-1297	CLIP-seq
MIRT889816	hsa-miR-26a	CLIP-seq
MIRT889817	hsa-miR-26b	CLIP-seq
MIRT889834	hsa-miR-3141	CLIP-seq
MIRT889835	hsa-miR-3180-5p	CLIP-seq
MIRT889821	hsa-miR-4282	CLIP-seq
MIRT889836	hsa-miR-4459	CLIP-seq
MIRT889823	hsa-miR-4465	CLIP-seq
MIRT889837	hsa-miR-4470	CLIP-seq
MIRT889824	hsa-miR-4698	CLIP-seq
MIRT889838	hsa-miR-4733-3p	CLIP-seq
MIRT889839	hsa-miR-4738-5p	CLIP-seq
MIRT889840	hsa-miR-4779	CLIP-seq
MIRT889841	hsa-miR-4795-3p	CLIP-seq
MIRT889826	hsa-miR-498	CLIP-seq
MIRT889828	hsa-miR-513a-3p	CLIP-seq
MIRT889842	hsa-miR-520a-5p	CLIP-seq
MIRT889843	hsa-miR-525-5p	CLIP-seq
MIRT889830	hsa-miR-548c-3p	CLIP-seq
MIRT889844	hsa-miR-665	CLIP-seq
MIRT1963662	hsa-miR-3193	CLIP-seq
MIRT1963663	hsa-miR-3649	CLIP-seq
MIRT1963664	hsa-miR-4274	CLIP-seq
MIRT1963665	hsa-miR-4323	CLIP-seq
MIRT1963666	hsa-miR-4328	CLIP-seq
MIRT1963667	hsa-miR-4467	CLIP-seq
MIRT1963668	hsa-miR-4519	CLIP-seq
MIRT1963669	hsa-miR-4520a-3p	CLIP-seq
MIRT1963670	hsa-miR-4520b-3p	CLIP-seq
MIRT1963671	hsa-miR-4524	CLIP-seq
MIRT1963672	hsa-miR-4529-3p	CLIP-seq
MIRT1963673	hsa-miR-492	CLIP-seq
MIRT1963674	hsa-miR-451b	CLIP-seq
MIRT2200010	hsa-miR-103a	CLIP-seq
MIRT2200011	hsa-miR-107	CLIP-seq
MIRT2200012	hsa-miR-1343	CLIP-seq
MIRT2200013	hsa-miR-15a	CLIP-seq
MIRT2200014	hsa-miR-15b	CLIP-seq
MIRT2200015	hsa-miR-16	CLIP-seq
MIRT2200016	hsa-miR-195	CLIP-seq
MIRT2200017	hsa-miR-3155	CLIP-seq
MIRT2200018	hsa-miR-3155b	CLIP-seq
MIRT1963662	hsa-miR-3193	CLIP-seq
MIRT1963663	hsa-miR-3649	CLIP-seq
MIRT2200019	hsa-miR-424	CLIP-seq
MIRT1963665	hsa-miR-4323	CLIP-seq
MIRT2200020	hsa-miR-4508	CLIP-seq
MIRT2200021	hsa-miR-484	CLIP-seq
MIRT1963673	hsa-miR-492	CLIP-seq
MIRT2200022	hsa-miR-497	CLIP-seq
MIRT2200010	hsa-miR-103a	CLIP-seq
MIRT2200011	hsa-miR-107	CLIP-seq
MIRT2200012	hsa-miR-1343	CLIP-seq
MIRT2200013	hsa-miR-15a	CLIP-seq
MIRT2200014	hsa-miR-15b	CLIP-seq
MIRT2200015	hsa-miR-16	CLIP-seq
MIRT2200016	hsa-miR-195	CLIP-seq
MIRT2200017	hsa-miR-3155	CLIP-seq
MIRT2200018	hsa-miR-3155b	CLIP-seq
MIRT1963662	hsa-miR-3193	CLIP-seq
MIRT2678086	hsa-miR-3648	CLIP-seq
MIRT1963663	hsa-miR-3649	CLIP-seq
MIRT2678087	hsa-miR-377	CLIP-seq
MIRT2200019	hsa-miR-424	CLIP-seq
MIRT1963665	hsa-miR-4323	CLIP-seq
MIRT2678088	hsa-miR-4457	CLIP-seq
MIRT2200020	hsa-miR-4508	CLIP-seq
MIRT2678089	hsa-miR-4731-3p	CLIP-seq
MIRT2678090	hsa-miR-4801	CLIP-seq
MIRT2200021	hsa-miR-484	CLIP-seq
MIRT1963673	hsa-miR-492	CLIP-seq
MIRT2200022	hsa-miR-497	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IDA	18172500
GO:0000209	Process	Protein polyubiquitination	IDA	19182791
GO:0004842	Function	Ubiquitin-protein transferase activity	IBA	21873635
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18172500, 19182791
GO:0005515	Function	Protein binding	IPI	15467728, 18172500, 19182791
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	18172500
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0007093	Process	Mitotic cell cycle checkpoint	IBA	21873635
GO:0007093	Process	Mitotic cell cycle checkpoint	IMP	18172500, 19182791
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016605	Component	PML body	IDA	15467728
GO:0019941	Process	Modification-dependent protein catabolic process	IDA	19182791
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031648	Process	Protein destabilization	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0044779	Process	Meiotic spindle checkpoint	IMP	10935642
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

Other IDs

• MIM: 605209
• HGNC: 20455
• e!Ensembl: ENSG00000072609

Protein

• UniProt ID: Q96EP1
• Protein name: E3 ubiquitin-protein ligase CHFR (EC 2.3.2.27) (Checkpoint with forkhead and RING finger domains protein) (RING finger protein 196) (RING-type E3 ubiquitin transferase CHFR)
• Protein function: E3 ubiquitin-protein ligase that functions in the antephase checkpoint by actively delaying passage into mitosis in response to microtubule poisons. Acts in early prophase before chromosome condensation, when the centrosome move apart from each
• PDB: 1LGP, 1LGQ, 2XOC, 2XOY, 2XOZ, 2XP0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00498	FHA	38 → 106	FHA domain	Family
  PF13923	zf-C3HC4_2	303 → 342		Domain
  PF17979	zf-CRD	462 → 620	Cysteine rich domain with multizinc binding regions	Domain
  PF10283	zf-CCHH	632 → 661	PBZ domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10935642}.
• Sequence:

  MERPEEGKQSPPPQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDH
  CRIVVDEKSGQVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLY
  ESLSEKQGMTQESFEANKENVFHGTKDTSGAGAGRGADPRVPPSSPATQVCFEEPQPSTS
  TSDLFPTASASSTEPSPAGRERSSSCGSGGGGISPKGSGPSVASDEVSSFASALPDRKTA
  SFSSLEPQDQEDLEPVKKKMRGDGDLDLNGQLLVAQPRRNAQTVHEDVRAAAGKPDKMEE
  TLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVE
  AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSD
  ISQPYVVCRQCPEYRRQAAQPPHCPAPEGEPGAPQALGDAPSTSVSLTTAVQDYVCPLQG
  SHALCTCCFQPMPDRRAEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELN
  LGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVL
  CYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQT
  RFKN

• Sequence length: 664

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Endometrial carcinoma	Endometrial Carcinoma	rs34612342, rs587776667, rs587776701, rs63750955, rs587776706, rs121434629, rs80359605, rs121913530, rs104894365, rs79184941, rs121913478, rs63750781, rs193922343, rs267608094, rs267608077, rs587779206, rs63750439, rs63751405, rs63750741, rs63750854, rs63750909, rs587779212, rs63749874, rs267608076, rs587779220, rs63750735, rs267608082, rs587779227, rs267608068, rs63750075, rs587779232, rs267608058, rs63751127, rs63750138, rs267608065, rs63751017, rs587779246, rs63750111, rs63750563, rs267608073, rs63751407, rs63749999, rs267608042, rs63750833, rs587779255, rs587779256, rs267608078, rs267608092, rs587779263, rs267608098, rs587779267, rs63750194, rs63751327, rs63751328, rs587779284, rs63749942, rs63751058, rs267608114, rs267608118, rs63751319, rs267608128, rs1553333594, rs267608126, rs63750767, rs267608120, rs267608121, rs267608122, rs63750342, rs63749873, rs587779318, rs63750019, rs63749980, rs267608048, rs1553412283, rs146816935, rs63750855, rs63751711, rs267607789, rs587779094, rs63750224, rs267607972, rs63750084, rs587779185, rs587778617, rs398123231, rs398123232, rs398123318, rs587780021, rs63750119, rs267608064, rs587781490, rs587781558, rs587781691, rs63749821, rs587782111, rs587782326, rs587782704, rs587779264, rs587779333, rs587782712, rs587783056, rs730881825, rs730881827, rs730881829, rs730881830, rs786202193, rs587782281, rs786202848, rs786201049, rs750528093, rs786202108, rs267608083, rs786201050, rs786203924, rs587781544, rs786201084, rs1553333738, rs863224829, rs863225398, rs863225409, rs863225412, rs864622041, rs869312769, rs869312770, rs63751077, rs876661205, rs876661025, rs63749919, rs876661073, rs876661222, rs267608041, rs878853702, rs751326348, rs866260675, rs886039666, rs886044911, rs1057517552, rs1057517764, rs1057517763, rs121909224, rs1057520605, rs1060502885, rs1060502918, rs1060502932, rs587779215, rs1060502937, rs1060502886, rs1060502875, rs1060502881, rs267607939, rs1023534466, rs1064793600, rs1064795256, rs1064795591, rs1064794055, rs1064794164, rs1553414010, rs1064793671, rs1064794302, rs1064793489, rs1064794384, rs1064793781, rs1553333500, rs760190301, rs1114167719, rs1114167776, rs1114167704, rs1114167748, rs1114167731, rs753796271, rs267608055, rs1114167746, rs1114167715, rs587782706, rs1114167750, rs1114167765, rs1114167747, rs786204048, rs1114167707, rs1114167767, rs1114167717, rs1114167783, rs1553412966, rs1553333598, rs587779297, rs1554294505, rs988423880, rs1554306353, rs1553408136, rs1553333321, rs1553408388, rs63749973, rs1553412064, rs1553412120, rs1553826166, rs1553413784, rs1553331242, rs1553414519, rs1564568660, rs1558392033, rs878853704, rs765763906, rs1558663559, rs1572720704, rs63750985, rs1572727440, rs587779253, rs1580538168, rs149350323, rs374133543, rs771721952, rs201033017, rs763478027, rs1475633334, rs1580553624, rs1580553669, rs578113271, rs757194485, rs539295465, rs778610412, rs758191157, rs1580597397, rs1580033751, rs751236312, rs376667075, rs1561486630, rs1561486632, rs777054839, rs1204002507, rs766672143, rs1580091499, rs1386063673, rs1450314617, rs1580027713, rs367544716, rs1488467945, rs1580053768, rs1580553607, rs1572720794, rs1572722039, rs1572723786, rs1572725235, rs1572728112, rs1175196087, rs1572741984, rs1580540688, rs1259647122, rs1580546793, rs1234762807, rs1580556516, rs1669245178, rs1669365820, rs756190979, rs371356175, rs766997264, rs1743353294, rs1379605717, rs770330684, rs1462955256, rs1744356274, rs1480047980, rs1744149615	17143476
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	16367923
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193	20705357

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma	Inhibit	25477232
Adenoma	Inhibit	12810945
Aneuploidy	Associate	14694445
Biliary Tract Neoplasms	Associate	15471559
Breast Neoplasms	Associate	14694445, 17596595
Carcinogenesis	Associate	15138487, 18763281, 19182791, 20109344
Carcinogenesis	Inhibit	18335050
Carcinoma Non Small Cell Lung	Associate	20855974, 25477232, 25828518
Carcinoma Squamous Cell	Associate	25065733
Cholangiocarcinoma	Associate	17550320
Chromosome Disorders	Associate	14694445
Colorectal Neoplasms	Inhibit	12810945
Colorectal Neoplasms	Associate	17167178, 17201143, 18204436, 30562637, 33811727
Digestive System Neoplasms	Associate	16827108
Endometrial Neoplasms	Associate	21792009
Esophageal Neoplasms	Associate	16827108
Esophagitis	Associate	16827108
Head and Neck Neoplasms	Inhibit	12810945
Lung Neoplasms	Associate	25477232
Lymphoma Non Hodgkin	Associate	24998186
Microsatellite Instability	Associate	19469003, 33811727
Nasopharyngeal Carcinoma	Associate	21535891
Neoplasm Metastasis	Associate	19182791, 25052224
Neoplasm Metastasis	Stimulate	37024798
Neoplasms	Associate	12810945, 15138487, 16123600, 16827108, 18204436, 19469003, 24252461, 25052224, 25065733
Neoplasms	Inhibit	15471559, 16554732, 17201143, 17596595, 18335050, 19182791, 19321445, 19326084, 21575600, 21710491, 21999220, 32466334, 37024798
Neoplasms Squamous Cell	Associate	16123600
Neurofibrosarcoma	Inhibit	16554732
Ovarian Neoplasms	Associate	29367628
Pancreatic Neoplasms	Associate	32943033
Rectal Neoplasms	Associate	25052224
Retinoblastoma	Associate	17604597, 22278416
Squamous Cell Carcinoma of Head and Neck	Associate	19787237, 25065733, 25147921
Stomach Neoplasms	Associate	15138487, 16827108, 18158559, 18763281, 19469003, 20109344, 24748501, 26769141, 37024798
Stomach Neoplasms	Inhibit	18335050
Thyroid cancer medullary	Associate	26690675
Uterine Cervical Neoplasms	Associate	17971771
Weight Gain	Associate	33436068