Gene Gene information from NCBI Gene database.
Entrez ID 55740
Gene name ENAH actin regulator
Gene symbol ENAH
Synonyms (NCBI Gene)
ENAMENANDPP1
Chromosome 1
Chromosome location 1q42.12
Summary This gene encodes a member of the enabled/ vasodilator-stimulated phosphoprotein. Members of this gene family are involved in actin-based motility. This protein is involved in regulating the assembly of actin filaments and modulates cell adhesion and moti
miRNA miRNA information provided by mirtarbase database.
1659
miRTarBase ID miRNA Experiments Reference
MIRT016152 hsa-miR-615-3p Sequencing 20371350
MIRT019694 hsa-miR-375 Microarray 20215506
MIRT021597 hsa-miR-142-3p Microarray 17612493
MIRT022252 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT025077 hsa-miR-181a-5p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 10801818, 16979624, 21044950, 21278383, 33961781
GO:0005522 Function Profilin binding IBA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609061 18271 ENSG00000154380
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N8S7
Protein name Protein enabled homolog
Protein function Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. ENAH induces the formatio
PDB 2HO2 , 2IYB , 2XQN , 4MY6 , 5N91 , 5N9C , 5N9P , 5NAJ , 5NBF , 5NBX , 5NC2 , 5NC7 , 5NCF , 5NCG , 5NCP , 5ND0 , 5NDU , 5NEG , 6RCF , 6RCJ , 6RD2 , 6XVT , 6XXR , 7A5M , 7AKI , 7LXE , 9C66
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00568 WH1 1 108 WH1 domain Domain
PF08776 VASP_tetra 552 588 VASP tetramerisation domain Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in myoepithelia of parotid, breast, bronchial glands and sweat glands. Expressed in colon-rectum muscolaris mucosae epithelium, pancreas acinar ductal epithelium, endometrium epithelium, prostate fibromuscolar stroma and plac
Sequence
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVI
NCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHAL
EVLNSQETGPTL
PRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERER
LERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLER
ERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAET
PSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQV
PPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG
VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPV
TSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPL
SQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA
Sequence length 591
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Rap1 signaling pathway
Axon guidance
Regulation of actin cytoskeleton
  Signaling by ROBO receptors