Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55738
Gene name Gene Name - the full gene name approved by the HGNC.
ARF GTPase activating protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARFGAP1
Synonyms (NCBI Gene) Gene synonyms aliases
ARF1GAP, HRIHFB2281
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a GTPase-activating protein, which associates with the Golgi apparatus and which interacts with ADP-ribosylation factor 1. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1-bound GTP and is required f
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT047930 hsa-miR-30c-5p CLASH 23622248
MIRT042628 hsa-miR-423-3p CLASH 23622248
MIRT038909 hsa-miR-93-3p CLASH 23622248
MIRT792746 hsa-miR-1343 CLIP-seq
MIRT792747 hsa-miR-1908 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IBA
GO:0005096 Function GTPase activator activity IBA
GO:0005096 Function GTPase activator activity IDA 22423108
GO:0005096 Function GTPase activator activity IEA
GO:0005515 Function Protein binding IPI 22363216, 25416956, 25910212, 32296183, 32814053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608377 15852 ENSG00000101199
Protein
UniProt ID Q8N6T3
Protein name ADP-ribosylation factor GTPase-activating protein 1 (ARF GAP 1) (ADP-ribosylation factor 1 GTPase-activating protein) (ARF1 GAP) (ARF1-directed GTPase-activating protein)
Protein function GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1). Involved in membrane trafficking and /or vesicle transport. Promotes hydrolysis of the ARF1-bound GTP and thus, is required for the dissociation of coat proteins from Golg
PDB 3DWD , 3O47
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01412 ArfGap 7 120 Putative GTPase activating protein for Arf Domain
Sequence
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVR
SVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAE

GREWSLESSPAQNWTPPQPRTLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQG
NRYVGFGNTPPPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQKA
SELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGKAEG
PLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRS
SDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW
Sequence length 406
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocytosis   XBP1(S) activates chaperone genes
COPI-mediated anterograde transport
COPI-dependent Golgi-to-ER retrograde traffic
Clathrin-mediated endocytosis
<