INTS13 (integrator complex subunit 13)

Gene

• Entrez ID: 55726
• Gene name: Integrator complex subunit 13
• Gene symbol: INTS13
• Synonyms (NCBI Gene): ASUN, C12orf11, GCT1, Mat89Bb, NET48, SPATA30
• Chromosome: 12
• Chromosome location: 12p11.23

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20195357, 26496610, 32647223, 33548203
GO:0005634	Component	Nucleus	IDA	39032490
GO:0005634	Component	Nucleus	IDA	23904267
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	NAS	32647223
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	23097494, 23904267
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0007052	Process	Mitotic spindle organization	IMP	23097494
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	15737938
GO:0016180	Process	SnRNA processing	IMP	32647223
GO:0016180	Process	SnRNA processing	NAS	16239144
GO:0016604	Component	Nuclear body	IDA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0032039	Component	Integrator complex	IBA
GO:0032039	Component	Integrator complex	IDA	32647223, 33548203, 36920904, 38823386, 38906142, 39032490
GO:0032039	Component	Integrator complex	NAS	33548203
GO:0034243	Process	Regulation of transcription elongation by RNA polymerase II	NAS	32697989
GO:0051301	Process	Cell division	IEA
GO:0051642	Process	Centrosome localization	IBA
GO:0051642	Process	Centrosome localization	IMP	23097494
GO:0080154	Process	Regulation of fertilization	ISS
GO:0090435	Process	Protein localization to nuclear envelope	IMP	23097494
GO:0140297	Function	DNA-binding transcription factor binding	IDA	38823386, 38906142
GO:0160232	Component	INTAC complex	IDA	38570683
GO:0160240	Process	RNA polymerase II transcription initiation surveillance	IDA	38570683

Other IDs

• MIM: 615079
• HGNC: 20174
• e!Ensembl: ENSG00000064102

Protein

• UniProt ID: Q9NVM9
• Protein name: Integrator complex subunit 13 (Cell cycle regulator Mat89Bb homolog) (Germ cell tumor 1) (Protein asunder homolog) (Sarcoma antigen NY-SAR-95)
• Protein function: Component of the integrator complex, a multiprotein complex that terminates RNA polymerase II (Pol II) transcription in the promoter-proximal region of genes (PubMed:38570683, PubMed:38823386). The integrator complex provides a quality checkpoin
• PDB: 6SN1, 8PK5, 8PK6, 8RBX, 8RBZ, 8RC4, 9EOC, 9EP1, 9FA4, 9FA7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10221	DUF2151	4 → 692	Cell cycle and development regulator	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Tends to be up-regulated in seminomas compared to normal testis. {ECO:0000269|PubMed:12414650}.
• Sequence:

  MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSM
  EYCRIMYDIFPFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECC
  SILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQ
  ETIHEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAG
  RHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH
  LGGGSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCLTNFLLNGRSV
  LLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGE
  FMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASV
  IVKESLTEEDVLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLV
  RAHINNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDS
  ERLKGILERGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNR
  INTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTENGKASRQ

• Sequence length: 706

Pathways

Reactome:

RNA polymerase II transcribes snRNA genes