ZNF334 (zinc finger protein 334)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 55713
Gene name Zinc finger protein 334
Gene symbol ZNF334
Synonyms (NCBI Gene)
-
Chromosome 20
Chromosome location 20q13.12
Summary This gene encodes a member of the C2H2 zinc finger family. The encoded protein contains a Krueppel-associated box, fourteen C2H2 zinc finger domains, and four C2H2-type/integrase DNA-binding domains. Decreased expression of this gene may be a marker for r
miRNA miRNA information provided by mirtarbase database.
7
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (7)
miRTarBase ID miRNA Experiments Reference
MIRT017255 hsa-miR-335-5p Microarray 18185580
MIRT1522599 hsa-miR-1284 CLIP-seq
MIRT1522600 hsa-miR-3680 CLIP-seq
MIRT1522601 hsa-miR-4729 CLIP-seq
MIRT1522602 hsa-miR-4798-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 32296183
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
621017 15806 ENSG00000198185
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HCZ1
Protein name Zinc finger protein 334
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 9 → 50 KRAB box Family
PF00096 zf-C2H2 238 → 259 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 265 → 287 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 293 → 315 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 321 → 343 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 349 → 371 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 378 → 399 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 405 → 430 Domain
PF00096 zf-C2H2 433 → 455 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 461 → 483 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 544 → 566 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 572 → 594 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 600 → 622 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 628 → 650 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 656 → 678 Zinc finger, C2H2 type Domain
Sequence 
MKMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGYHVSKPDVIF
KLEQGEEPWIVEEFSNQNYPDIDDALEKNKEIQDKHLTQTVFFSNKTLITERENVFGKTL
NLGMNSVPSRKMPYKCNPGGNSLKTNSEVIVAKKSKENRKIPDGYSGFGKHEKSHLGMKK
YRYNPMRKASNQNENLILHQNIQILKQPFDYNKCGKTFFKRAILITQKGRQTERKPNECN
ECRKTFSKRSTLIVHQRIHTGEKPYVCSDCRKTFRVKTSLTRHRRIHTGERPYECSECRK
TFIDKSALIVHQKIHGGEKSYECNECGKTFFRKSALAEHFRSHTGEKPYECKECGNAFSK
KSYLVVHQRTHRGEKPNECKECGKTFFCQSALTAHQRIHTGEKPYECSECEKTFFCQSAL
NVHRRSHTGEKPYECSQCGKFLCTKSALIAHQITHRGKKSYECNECGKFFCHKSTLTIHQ
RTHTGEKHGVFNKCGRISIVKSNCSQCKRMNTKENLYECSEHGHAVSKNSHLIVHQRTIW
ERPYECNECGRTYCRKSALTHHQRTHTGQRPYECNECGKTFCQKFSFVEHQRTHTGEKPY
ECNECGKSFCHKSAFRVHRRIHTGEKPYECNQCGKTYRRLWTLTEHQKIHTGEKPYECNK
CEKTFRHKSNFLLHQKSHKE
Sequence length 680
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (2)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEMENTIA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (6)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Arthritis Rheumatoid Inhibit 20738421, 25738173
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 35534462
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 36966142
★★★★★
★☆☆☆☆
Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome Inhibit 35507080
★★★★★
★☆☆☆☆
Found in Text Mining only
Neoplasms Inhibit 35507080, 35534462
★★★★★
★☆☆☆☆
Found in Text Mining only
Triple Negative Breast Neoplasms Inhibit 35507080
★★★★★
★☆☆☆☆
Found in Text Mining only