Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55704
Gene name	Coiled-coil and HOOK domain protein 88A
Gene symbol	CCDC88A
Synonyms (NCBI Gene)	APEGIRDINGIVGRDNHkRP1KIAA1212PEHOPEHOL
Chromosome	2
Chromosome location	2p16.1
Summary	This gene encodes a member of the Girdin family of coiled-coil domain containing proteins. The encoded protein is an actin-binding protein that is activated by the serine/threonine kinase Akt and plays a role in cytoskeleton remodeling and cell migration.

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs879255649	A>-	Pathogenic	Coding sequence variant, stop gained

156

Show/Hide all (156)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019700	hsa-miR-375	Microarray	20215506
MIRT053777	hsa-miR-4448	ChIP-seqFlowMicroarrayqRT-PCRWestern blot	24861464
MIRT499574	hsa-miR-4311	PAR-CLIP	24398324
MIRT499573	hsa-miR-583	PAR-CLIP	24398324
MIRT499572	hsa-miR-6873-5p	PAR-CLIP	24398324
MIRT499571	hsa-miR-6760-5p	PAR-CLIP	24398324
MIRT499570	hsa-miR-4419a	PAR-CLIP	24398324
MIRT499569	hsa-miR-4510	PAR-CLIP	24398324
MIRT499568	hsa-miR-6127	PAR-CLIP	24398324
MIRT499567	hsa-miR-6129	PAR-CLIP	24398324
MIRT499566	hsa-miR-6130	PAR-CLIP	24398324
MIRT499565	hsa-miR-6133	PAR-CLIP	24398324
MIRT499564	hsa-miR-185-5p	PAR-CLIP	24398324
MIRT499563	hsa-miR-4306	PAR-CLIP	24398324
MIRT499561	hsa-miR-4644	PAR-CLIP	24398324
MIRT499562	hsa-miR-6731-5p	PAR-CLIP	24398324
MIRT499560	hsa-miR-8085	PAR-CLIP	24398324
MIRT499564	hsa-miR-185-5p	PAR-CLIP	27292025
MIRT499563	hsa-miR-4306	PAR-CLIP	27292025
MIRT499574	hsa-miR-4311	PAR-CLIP	27292025
MIRT499570	hsa-miR-4419a	PAR-CLIP	27292025
MIRT499569	hsa-miR-4510	PAR-CLIP	27292025
MIRT499561	hsa-miR-4644	PAR-CLIP	27292025
MIRT499573	hsa-miR-583	PAR-CLIP	27292025
MIRT499568	hsa-miR-6127	PAR-CLIP	27292025
MIRT499567	hsa-miR-6129	PAR-CLIP	27292025
MIRT499566	hsa-miR-6130	PAR-CLIP	27292025
MIRT499565	hsa-miR-6133	PAR-CLIP	27292025
MIRT499562	hsa-miR-6731-5p	PAR-CLIP	27292025
MIRT499571	hsa-miR-6760-5p	PAR-CLIP	27292025
MIRT499572	hsa-miR-6873-5p	PAR-CLIP	27292025
MIRT499560	hsa-miR-8085	PAR-CLIP	27292025
MIRT499574	hsa-miR-4311	PAR-CLIP	24398324
MIRT499573	hsa-miR-583	PAR-CLIP	24398324
MIRT499572	hsa-miR-6873-5p	PAR-CLIP	24398324
MIRT499571	hsa-miR-6760-5p	PAR-CLIP	24398324
MIRT499570	hsa-miR-4419a	PAR-CLIP	24398324
MIRT499569	hsa-miR-4510	PAR-CLIP	24398324
MIRT499568	hsa-miR-6127	PAR-CLIP	24398324
MIRT499567	hsa-miR-6129	PAR-CLIP	24398324
MIRT499566	hsa-miR-6130	PAR-CLIP	24398324
MIRT499565	hsa-miR-6133	PAR-CLIP	24398324
MIRT499564	hsa-miR-185-5p	PAR-CLIP	24398324
MIRT499563	hsa-miR-4306	PAR-CLIP	24398324
MIRT499561	hsa-miR-4644	PAR-CLIP	24398324
MIRT499562	hsa-miR-6731-5p	PAR-CLIP	24398324
MIRT499560	hsa-miR-8085	PAR-CLIP	24398324
MIRT870106	hsa-miR-3688-3p	CLIP-seq
MIRT870107	hsa-miR-4422	CLIP-seq
MIRT870108	hsa-miR-4424	CLIP-seq
MIRT870109	hsa-miR-603	CLIP-seq
MIRT870110	hsa-miR-185	CLIP-seq
MIRT870111	hsa-miR-3120-3p	CLIP-seq
MIRT870112	hsa-miR-3153	CLIP-seq
MIRT870106	hsa-miR-3688-3p	CLIP-seq
MIRT870113	hsa-miR-3978	CLIP-seq
MIRT870114	hsa-miR-4272	CLIP-seq
MIRT870115	hsa-miR-4310	CLIP-seq
MIRT870116	hsa-miR-4330	CLIP-seq
MIRT870117	hsa-miR-4506	CLIP-seq
MIRT870118	hsa-miR-4659a-5p	CLIP-seq
MIRT870119	hsa-miR-4659b-5p	CLIP-seq
MIRT870120	hsa-miR-4668-5p	CLIP-seq
MIRT870121	hsa-miR-4775	CLIP-seq
MIRT870122	hsa-miR-4776-3p	CLIP-seq
MIRT870123	hsa-miR-510	CLIP-seq
MIRT870124	hsa-miR-512-5p	CLIP-seq
MIRT870109	hsa-miR-603	CLIP-seq
MIRT870125	hsa-miR-618	CLIP-seq
MIRT870110	hsa-miR-185	CLIP-seq
MIRT1958341	hsa-miR-4680-5p	CLIP-seq
MIRT1958342	hsa-miR-9	CLIP-seq
MIRT2195105	hsa-miR-129-5p	CLIP-seq
MIRT2195106	hsa-miR-3692	CLIP-seq
MIRT2195107	hsa-miR-4717-3p	CLIP-seq
MIRT2195108	hsa-miR-4742-3p	CLIP-seq
MIRT2195109	hsa-miR-4768-5p	CLIP-seq
MIRT2195110	hsa-miR-4802-3p	CLIP-seq
MIRT2195111	hsa-miR-586	CLIP-seq
MIRT2195112	hsa-miR-656	CLIP-seq
MIRT2385678	hsa-miR-3606	CLIP-seq
MIRT2385679	hsa-miR-921	CLIP-seq
MIRT2446439	hsa-miR-606	CLIP-seq
MIRT2498415	hsa-miR-1261	CLIP-seq
MIRT2498416	hsa-miR-1272	CLIP-seq
MIRT2498417	hsa-miR-1278	CLIP-seq
MIRT2498418	hsa-miR-1294	CLIP-seq
MIRT2498419	hsa-miR-141	CLIP-seq
MIRT2498420	hsa-miR-181a	CLIP-seq
MIRT2498421	hsa-miR-181b	CLIP-seq
MIRT2498422	hsa-miR-181c	CLIP-seq
MIRT2498423	hsa-miR-181d	CLIP-seq
MIRT2498424	hsa-miR-200a	CLIP-seq
MIRT2498425	hsa-miR-208a	CLIP-seq
MIRT2498426	hsa-miR-208b	CLIP-seq
MIRT2498427	hsa-miR-298	CLIP-seq
MIRT870111	hsa-miR-3120-3p	CLIP-seq
MIRT2498428	hsa-miR-3617	CLIP-seq
MIRT2195106	hsa-miR-3692	CLIP-seq
MIRT2498429	hsa-miR-369-3p	CLIP-seq
MIRT2498430	hsa-miR-374a	CLIP-seq
MIRT2498431	hsa-miR-374b	CLIP-seq
MIRT2498432	hsa-miR-4262	CLIP-seq
MIRT2498433	hsa-miR-4289	CLIP-seq
MIRT870115	hsa-miR-4310	CLIP-seq
MIRT2498434	hsa-miR-4316	CLIP-seq
MIRT2498435	hsa-miR-4438	CLIP-seq
MIRT2498436	hsa-miR-4503	CLIP-seq
MIRT2498437	hsa-miR-4517	CLIP-seq
MIRT2498438	hsa-miR-4524	CLIP-seq
MIRT2195108	hsa-miR-4742-3p	CLIP-seq
MIRT2498439	hsa-miR-4760-3p	CLIP-seq
MIRT2195109	hsa-miR-4768-5p	CLIP-seq
MIRT870121	hsa-miR-4775	CLIP-seq
MIRT2195110	hsa-miR-4802-3p	CLIP-seq
MIRT2498440	hsa-miR-490-5p	CLIP-seq
MIRT2498441	hsa-miR-499-5p	CLIP-seq
MIRT2498442	hsa-miR-501-3p	CLIP-seq
MIRT2498443	hsa-miR-502-3p	CLIP-seq
MIRT870125	hsa-miR-618	CLIP-seq
MIRT2498444	hsa-miR-641	CLIP-seq
MIRT2498415	hsa-miR-1261	CLIP-seq
MIRT2498416	hsa-miR-1272	CLIP-seq
MIRT2498417	hsa-miR-1278	CLIP-seq
MIRT2677507	hsa-miR-128	CLIP-seq
MIRT2498418	hsa-miR-1294	CLIP-seq
MIRT2498419	hsa-miR-141	CLIP-seq
MIRT2498424	hsa-miR-200a	CLIP-seq
MIRT2498425	hsa-miR-208a	CLIP-seq
MIRT2498426	hsa-miR-208b	CLIP-seq
MIRT2677508	hsa-miR-2116	CLIP-seq
MIRT2498427	hsa-miR-298	CLIP-seq
MIRT2677509	hsa-miR-3198	CLIP-seq
MIRT2498428	hsa-miR-3617	CLIP-seq
MIRT2498429	hsa-miR-369-3p	CLIP-seq
MIRT2498430	hsa-miR-374a	CLIP-seq
MIRT2498431	hsa-miR-374b	CLIP-seq
MIRT2677510	hsa-miR-4273	CLIP-seq
MIRT2498433	hsa-miR-4289	CLIP-seq
MIRT2677511	hsa-miR-4309	CLIP-seq
MIRT2498434	hsa-miR-4316	CLIP-seq
MIRT2677512	hsa-miR-432	CLIP-seq
MIRT2498435	hsa-miR-4438	CLIP-seq
MIRT2677513	hsa-miR-4445	CLIP-seq
MIRT2498436	hsa-miR-4503	CLIP-seq
MIRT2498437	hsa-miR-4517	CLIP-seq
MIRT2498438	hsa-miR-4524	CLIP-seq
MIRT2677514	hsa-miR-4677-5p	CLIP-seq
MIRT2498439	hsa-miR-4760-3p	CLIP-seq
MIRT2195110	hsa-miR-4802-3p	CLIP-seq
MIRT2498440	hsa-miR-490-5p	CLIP-seq
MIRT2498441	hsa-miR-499-5p	CLIP-seq
MIRT2498442	hsa-miR-501-3p	CLIP-seq
MIRT2498443	hsa-miR-502-3p	CLIP-seq
MIRT870125	hsa-miR-618	CLIP-seq
MIRT2498444	hsa-miR-641	CLIP-seq

Show/Hide all (69)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0001965	Function	G-protein alpha-subunit binding	IPI	19211784, 23509302, 27621449
GO:0003779	Function	Actin binding	IDA	16139227
GO:0005080	Function	Protein kinase C binding	IPI	23509302
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	19211784, 23509302, 27864364
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005092	Function	GDP-dissociation inhibitor activity	IDA	27621449
GO:0005154	Function	Epidermal growth factor receptor binding	IPI	20462955, 25187647
GO:0005158	Function	Insulin receptor binding	IPI	25187647
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	15882442
GO:0005794	Component	Golgi apparatus	IDA	15882442
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA
GO:0005814	Component	Centriole	IDA	27623382
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	IDA	15749703, 27864364
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	15882442, 27864364
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IDA	19211784, 23509302, 27621449, 27864364
GO:0007399	Process	Nervous system development	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	ISS
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010975	Process	Regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IDA	15749703, 15882442
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IMP	16139227
GO:0030027	Component	Lamellipodium	IDA	16139227
GO:0030027	Component	Lamellipodium	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030032	Process	Lamellipodium assembly	IMP	16139227
GO:0030705	Process	Cytoskeleton-dependent intracellular transport	IBA
GO:0030705	Process	Cytoskeleton-dependent intracellular transport	IEA
GO:0031122	Process	Cytoplasmic microtubule organization	IBA
GO:0031252	Component	Cell leading edge	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	15882442
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031929	Process	TOR signaling	IEA
GO:0031929	Process	TOR signaling	ISS
GO:0032147	Process	Activation of protein kinase activity	IDA	21954290
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	16139227
GO:0035091	Function	Phosphatidylinositol binding	IDA	16139227
GO:0036064	Component	Ciliary basal body	IDA	27623382
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	ISS
GO:0042169	Function	SH2 domain binding	IPI	21954290
GO:0042803	Function	Protein homodimerization activity	IPI	16139227
GO:0042995	Component	Cell projection	IEA
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	25187647
GO:0043422	Function	Protein kinase B binding	IEA
GO:0043422	Function	Protein kinase B binding	IPI	16139227
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	ISS
GO:0045724	Process	Positive regulation of cilium assembly	IMP	27623382
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IDA	20462955
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	16139227
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051959	Function	Dynein light intermediate chain binding	IBA
GO:0061024	Process	Membrane organization	IDA	15882442
GO:0072660	Process	Maintenance of protein location in plasma membrane	IDA	20462955
GO:1903566	Process	Positive regulation of protein localization to cilium	IMP	27623382

MIM	HGNC	e!Ensembl
609736	25523	ENSG00000115355

Q3V6T2

Protein name

Girdin (Akt phosphorylation enhancer) (APE) (Coiled-coil domain-containing protein 88A) (G alpha-interacting vesicle-associated protein) (GIV) (Girders of actin filament) (Hook-related protein 1) (HkRP1)

Protein function

Bifunctional modulator of guanine nucleotide-binding proteins (G proteins) (PubMed:19211784, PubMed:27621449). Acts as a non-receptor guanine nucleotide exchange factor which binds to and activates guanine nucleotide-binding protein G(i) alpha s

PDB

6MHF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF19047	HOOK_N	13 → 167	HOOK domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed ubiquitously. {ECO:0000269|PubMed:16139227}.

Sequence

MENEIFTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALVDGVFLNQVMLQINPKLE
SQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEE
VKKLLLLLLGCAVQCQKKEEFIERIQGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTD
MSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGM
KRTESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLS
DARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETK
TMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQK
QSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELR
TTVDSVEGNASKILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEK
TIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETS
SKLSKIEFEKRQIKKELEHYKEKGERAEELENELHHLEKENELLQKKITNLKITCEKIEA
LEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKM
AQLQLENKELESEKEQLKKGLELLKASFKKTERLEVSYQGLDIENQRLQKTLENSNKKIQ
QLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKR
LRQQAEIKDTTLEENNVKIGNLEKENKTLSKEIGIYKESCVRLKELEKENKELVKRATID
IKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDSRYKLLESK
LESTLKKSLEIKEEKIAALEARLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSS
PPISGEDNKWERESQETTRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQ
AQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENE
SVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHRDLED
RYNQLLKQKGQLEDLEKMLKVEQEKMLLENKNHETVAAEYKKLCGENDRLNHTYSQLLKE
TEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNL
EEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQ
YKFYDPSPPRRRGNWITLKMRKLIKSKKDINRERQKSLTLTPTRSDSSEGFLQLPHQDSQ
DSSSVGSNSLEDGQTLGTKKSSMVALKRLPFLRNRPKDKDKMKACYRRSMSMNDLVQSMV
LAGQWTGSTENLEVPDDISTGKRRKELGAMAFSTTAINFSTVNSSAGFRSKQLVNNKDTT
SFEDISPQGVSDDSSTGSRVHASRPASLDSGRTSTSNSNNNASLHEVKAGAVNNQSRPQS
HSSGEFSLLHDHEAWSSSGSSPIQYLKRQTRSSPVLQHKISETLESRHHKIKTGSPGSEV
VTLQQFLEESNKLTSVQIKSSSQENLLDEVMKSLSVSSDFLGKDKPVSCGLARSVSGKTP
GDFYDRRTTKPEFLRPGPRKTEDTYFISSAGKPTPGTQGKIKLVKESSLSRQSKDSNPYA
TLPRASSVISTAEGTTRRTSIHDFLTKDSRLPISVDSPPAAADSNTTAASNVDKVQESRN
SKSRSREQQSS

Sequence length

1871

Interactions

View interactions

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
PEHO-like syndrome	Pathogenic	rs2104690231, rs2104596456, rs879255649	RCV004783994 RCV004784018 RCV000239462

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Likely benign	rs769803137	RCV005928663
Autism spectrum disorder	Uncertain significance	rs375580003	RCV005863507
CCDC88A-related disorder	Benign; Likely benign	rs543844398, rs377229921, rs759199436, rs41281505, rs138802311, rs897388237, rs144393509, rs150978572, rs147639776, rs142831465, rs2289168, rs145664496	RCV003956192 RCV003903536 RCV003951009 RCV003941278 RCV003933425 RCV003933491 RCV003935830 RCV003936081 RCV003905857 RCV003910574 RCV003932853 RCV003942926
Developmental delay	Uncertain significance	rs375580003	RCV005863507
Lung cancer	Likely benign	rs537426993	RCV005921239
Microcephaly	Uncertain significance	rs753827397	RCV001252780
PEHO syndrome	Conflicting classifications of pathogenicity	rs140794014	RCV001009548
Thyroid cancer, nonmedullary, 1	Uncertain significance	rs200076624	RCV005924245

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	25066397
Brain Diseases	Associate	36329890, 39334473
Breast Neoplasms	Associate	23066027, 27440794
Carcinoma Hepatocellular	Associate	25755745, 26743900, 27623945, 28810896, 33660763, 34190023, 35493459, 35960100
Carcinoma Non Small Cell Lung	Associate	26524953
Carcinoma Pancreatic Ductal	Associate	27919290, 32467989
Central Nervous System Vascular Malformations	Associate	39334473
Classical Lissencephalies and Subcortical Band Heterotopias	Associate	39334473
Colorectal Neoplasms	Associate	20974669, 25009397, 27029492
Developmental Disabilities	Associate	39334473
Diabetes Mellitus	Inhibit	36329890
Edema	Associate	39334473
Epilepsy	Associate	39334473
Esophageal Squamous Cell Carcinoma	Associate	32583631
Glioma	Associate	24288520, 26151295
Hepatitis B	Stimulate	34190023
Hereditary pancreatitis	Associate	20974669
Immune System Diseases	Associate	40401444
Immunologic Deficiency Syndromes	Associate	40401444
Leukemia Lymphocytic Chronic B Cell	Associate	29196338
Lymphatic Metastasis	Associate	35770962
Malformations of Cortical Development	Associate	39334473, 40401444
Microcephaly	Associate	40401444
Neoplasm Metastasis	Associate	20974669, 23066027, 24288520, 28810896, 30536309, 32467989, 35770962, 35960100
Neoplasms	Associate	20974669, 23066027, 25755745, 26524953, 26743900, 26916336, 32467989, 35493459, 35770962, 35960100, 36604355, 37382632, 37503752, 37923359
Neoplasms	Stimulate	32369440
Nervous System Diseases	Associate	40401444
Neurodegenerative Diseases	Associate	36329890
Osteosarcoma	Associate	37532779
Pancreatic Neoplasms	Associate	27919290, 30358104, 32467989, 37503752
Pancreatic Neoplasms	Stimulate	32369440
PEHO syndrome	Associate	39334473
Sarcoma Kaposi	Associate	40401444
Seizures	Associate	39334473, 40401444
Spasms Infantile	Associate	39334473
Stomach Neoplasms	Associate	35770962, 36604355
Turcot syndrome	Associate	27029492
Wilms Tumor	Associate	30536309
Zellweger Syndrome	Associate	26743900

CCDC88A (coiled-coil and HOOK domain protein 88A)