PKIB (cAMP-dependent protein kinase inhibitor beta)

Gene

• Entrez ID: 5570
• Gene name: CAMP-dependent protein kinase inhibitor beta
• Gene symbol: PKIB
• Synonyms (NCBI Gene): PRKACN2
• Chromosome: 6
• Chromosome location: 6q22.31
• Summary: This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1237515	hsa-miR-1324	CLIP-seq
MIRT1237516	hsa-miR-148a	CLIP-seq
MIRT1237517	hsa-miR-148b	CLIP-seq
MIRT1237518	hsa-miR-152	CLIP-seq
MIRT1237519	hsa-miR-205	CLIP-seq
MIRT1237520	hsa-miR-299-5p	CLIP-seq
MIRT1237521	hsa-miR-3940-5p	CLIP-seq
MIRT1237522	hsa-miR-4276	CLIP-seq
MIRT1237523	hsa-miR-4507	CLIP-seq
MIRT1237524	hsa-miR-586	CLIP-seq
MIRT1237525	hsa-miR-629	CLIP-seq
MIRT1237515	hsa-miR-1324	CLIP-seq
MIRT1237520	hsa-miR-299-5p	CLIP-seq
MIRT1237521	hsa-miR-3940-5p	CLIP-seq
MIRT1237523	hsa-miR-4507	CLIP-seq
MIRT1237526	hsa-miR-4731-3p	CLIP-seq
MIRT1237527	hsa-miR-4801	CLIP-seq
MIRT1237528	hsa-miR-548ac	CLIP-seq
MIRT1237529	hsa-miR-548ae	CLIP-seq
MIRT1237530	hsa-miR-548aj	CLIP-seq
MIRT1237531	hsa-miR-548am	CLIP-seq
MIRT1237532	hsa-miR-548d-3p	CLIP-seq
MIRT1237533	hsa-miR-548x	CLIP-seq
MIRT1237534	hsa-miR-548z	CLIP-seq
MIRT1237524	hsa-miR-586	CLIP-seq
MIRT1237525	hsa-miR-629	CLIP-seq
MIRT2297207	hsa-miR-548c-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004860	Function	Protein kinase inhibitor activity	IEA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IBA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	21531765

Other IDs

• MIM: 606914
• HGNC: 9018
• e!Ensembl: ENSG00000135549

Protein

• UniProt ID: Q9C010
• Protein name: cAMP-dependent protein kinase inhibitor beta (PKI-beta)
• Protein function: Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02827	PKI	9 → 77	cAMP-dependent protein kinase inhibitor	Family

• Sequence:

  MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKE
  KDEKTTQDQLEKPQNEEK

• Sequence length: 78

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	28387904	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	27325557	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	27325557	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	35817785	★☆☆☆☆ Found in Text Mining only
Genomic Instability	Associate	35817785	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	27325557	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	27325557, 28387904	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	28387904	★☆☆☆☆ Found in Text Mining only