Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5568
Gene name	Protein kinase cAMP-activated catalytic subunit gamma
Gene symbol	PRKACG
Synonyms (NCBI Gene)	BDPLT19KAPGPKACg
Chromosome	9
Chromosome location	9q21.11
Summary	Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs724159972	G>C	Pathogenic	Missense variant, coding sequence variant

Show/Hide all (37)

miRTarBase ID	miRNA	Experiments
MIRT1262351	hsa-miR-1207-3p	CLIP-seq
MIRT1262352	hsa-miR-138	CLIP-seq
MIRT1262353	hsa-miR-1915	CLIP-seq
MIRT1262354	hsa-miR-298	CLIP-seq
MIRT1262355	hsa-miR-3126-5p	CLIP-seq
MIRT1262356	hsa-miR-3154	CLIP-seq
MIRT1262357	hsa-miR-3159	CLIP-seq
MIRT1262358	hsa-miR-3160-3p	CLIP-seq
MIRT1262359	hsa-miR-3179	CLIP-seq
MIRT1262360	hsa-miR-3667-3p	CLIP-seq
MIRT1262361	hsa-miR-4251	CLIP-seq
MIRT1262362	hsa-miR-4419a	CLIP-seq
MIRT1262363	hsa-miR-4492	CLIP-seq
MIRT1262364	hsa-miR-4498	CLIP-seq
MIRT1262365	hsa-miR-4510	CLIP-seq
MIRT1262366	hsa-miR-4514	CLIP-seq
MIRT1262367	hsa-miR-4645-5p	CLIP-seq
MIRT1262368	hsa-miR-4673	CLIP-seq
MIRT1262369	hsa-miR-4692	CLIP-seq
MIRT1262370	hsa-miR-4694-5p	CLIP-seq
MIRT1262371	hsa-miR-4710	CLIP-seq
MIRT1262372	hsa-miR-4726-3p	CLIP-seq
MIRT1262373	hsa-miR-539	CLIP-seq
MIRT1262374	hsa-miR-646	CLIP-seq
MIRT1262375	hsa-miR-762	CLIP-seq
MIRT1262376	hsa-miR-940	CLIP-seq
MIRT1262353	hsa-miR-1915	CLIP-seq
MIRT2077353	hsa-miR-3183	CLIP-seq
MIRT1262360	hsa-miR-3667-3p	CLIP-seq
MIRT1262366	hsa-miR-4514	CLIP-seq
MIRT1262367	hsa-miR-4645-5p	CLIP-seq
MIRT1262368	hsa-miR-4673	CLIP-seq
MIRT1262369	hsa-miR-4692	CLIP-seq
MIRT2077354	hsa-miR-4723-3p	CLIP-seq
MIRT1262372	hsa-miR-4726-3p	CLIP-seq
MIRT1262376	hsa-miR-940	CLIP-seq
MIRT1262355	hsa-miR-3126-5p	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003091	Process	Renal water homeostasis	TAS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004691	Function	CAMP-dependent protein kinase activity	IBA
GO:0004691	Function	CAMP-dependent protein kinase activity	IEA
GO:0004691	Function	CAMP-dependent protein kinase activity	TAS	9598317
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005952	Component	CAMP-dependent protein kinase complex	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007283	Process	Spermatogenesis	TAS	9598317
GO:0008584	Process	Male gonad development	TAS	9598317
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0034237	Function	Protein kinase A regulatory subunit binding	IBA
GO:0034380	Process	High-density lipoprotein particle assembly	TAS
GO:0097546	Component	Ciliary base	TAS
GO:0097700	Process	Vascular endothelial cell response to laminar fluid shear stress	TAS
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
176893	9382	ENSG00000165059

P22612

Protein name

cAMP-dependent protein kinase catalytic subunit gamma (PKA C-gamma) (EC 2.7.11.11)

Protein function

Phosphorylates a large number of substrates in the cytoplasm and the nucleus.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	44 → 298	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.

Sequence

MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF

Sequence length

351

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance MAPK signaling pathway Ras signaling pathway Calcium signaling pathway cAMP signaling pathway Chemokine signaling pathway Hormone signaling Oocyte meiosis Autophagy - animal Longevity regulating pathway Longevity regulating pathway - multiple species Adrenergic signaling in cardiomyocytes Vascular smooth muscle contraction Wnt signaling pathway Hedgehog signaling pathway Apelin signaling pathway Tight junction Gap junction Platelet activation Circadian entrainment Thermogenesis Long-term potentiation Retrograde endocannabinoid signaling Glutamatergic synapse Cholinergic synapse Serotonergic synapse GABAergic synapse Dopaminergic synapse Olfactory transduction Taste transduction Inflammatory mediator regulation of TRP channels Insulin signaling pathway Insulin secretion GnRH signaling pathway Ovarian steroidogenesis Progesterone-mediated oocyte maturation Estrogen signaling pathway Melanogenesis Thyroid hormone synthesis Thyroid hormone signaling pathway Oxytocin signaling pathway Glucagon signaling pathway Regulation of lipolysis in adipocytes Renin secretion Aldosterone synthesis and secretion Relaxin signaling pathway Cortisol synthesis and secretion Parathyroid hormone synthesis, secretion and action Cushing syndrome Growth hormone synthesis, secretion and action Endocrine and other factor-regulated calcium reabsorption Vasopressin-regulated water reabsorption Salivary secretion Gastric acid secretion Bile secretion Parkinson disease Prion disease Cocaine addiction Amphetamine addiction Morphine addiction Alcoholism Vibrio cholerae infection Amoebiasis Human cytomegalovirus infection Human papillomavirus infection Human T-cell leukemia virus 1 infection Pathways in cancer Viral carcinogenesis Proteoglycans in cancer Chemical carcinogenesis - receptor activation Dilated cardiomyopathy		PKA activation PKA activation in glucagon signalling DARPP-32 events Glucagon-like Peptide-1 (GLP1) regulates insulin secretion Rap1 signalling Regulation of insulin secretion Vasopressin regulates renal water homeostasis via Aquaporins VEGFA-VEGFR2 Pathway CREB1 phosphorylation through the activation of Adenylate Cyclase GLI3 is processed to GLI3R by the proteasome Hedgehog 'off' state CD209 (DC-SIGN) signaling MAPK6/MAPK4 signaling RET signaling HDL assembly ADORA2B mediated anti-inflammatory cytokines production FCGR3A-mediated IL10 synthesis Factors involved in megakaryocyte development and platelet production

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Platelet-type bleeding disorder 19	no classifications from unflagged records	rs724159972	RCV000149789
PRKACG-related disorder	Uncertain significance; Likely benign; Benign	rs148063597, rs369389606, rs374148103, rs1329198202, rs143625692	RCV003941162 RCV003929559 RCV003942007 RCV003931666 RCV003969799

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Blood Platelet Disorders	Associate	25061177
Breast Neoplasms	Associate	33991172
Gonadal Dysgenesis 46 XY	Associate	24055526
Hemorrhage	Associate	25323684
Leukemia Myeloid Acute	Associate	30289875
Macrothrombocytopenia Autosomal Dominant Tubb1 Related	Associate	25061177
Melanoma	Associate	24185007
Neoplasms	Associate	35505292
Purpura Thrombocytopenic Idiopathic	Associate	33222560
Thrombasthenia Thrombocytopenia Hereditary	Associate	25061177
Tomaculous neuropathy	Associate	25061177

PRKACG (protein kinase cAMP-activated catalytic subunit gamma)