ZNF692 (zinc finger protein 692)

Gene

• Entrez ID: 55657
• Gene name: Zinc finger protein 692
• Gene symbol: ZNF692
• Synonyms (NCBI Gene): AREBP, Zfp692
• Chromosome: 1
• Chromosome location: 1q44

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1535752	hsa-miR-2355-3p	CLIP-seq
MIRT1535753	hsa-miR-4476	CLIP-seq
MIRT1535754	hsa-miR-4646-3p	CLIP-seq
MIRT1535755	hsa-miR-548a-5p	CLIP-seq
MIRT1535756	hsa-miR-548ab	CLIP-seq
MIRT1535757	hsa-miR-548ak	CLIP-seq
MIRT1535758	hsa-miR-548b-5p	CLIP-seq
MIRT1535759	hsa-miR-548c-5p	CLIP-seq
MIRT1535760	hsa-miR-548d-5p	CLIP-seq
MIRT1535761	hsa-miR-548h	CLIP-seq
MIRT1535762	hsa-miR-548i	CLIP-seq
MIRT1535763	hsa-miR-548j	CLIP-seq
MIRT1535764	hsa-miR-548k	CLIP-seq
MIRT1535765	hsa-miR-548l	CLIP-seq
MIRT1535766	hsa-miR-548w	CLIP-seq
MIRT1535767	hsa-miR-548y	CLIP-seq
MIRT1535768	hsa-miR-559	CLIP-seq
MIRT1535769	hsa-miR-651	CLIP-seq
MIRT1535770	hsa-miR-676	CLIP-seq
MIRT1535771	hsa-miR-7	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17097062
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	17097062
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	17097062
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0006111	Process	Regulation of gluconeogenesis	IMP	21910974
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0080090	Process	Regulation of primary metabolic process	IEA

Other IDs

• MIM: 617758
• HGNC: 26049
• e!Ensembl: ENSG00000171163

Protein

• UniProt ID: Q9BU19
• Protein name: Zinc finger protein 692 (AICAR responsive element binding protein)
• Protein function: May act as an transcriptional repressor for PCK1 gene expression, in turn may participate in the hepatic gluconeogenesis regulation through the activated AMPK signaling pathway.
• PDB: 2D9H, 2DLK, 6H0G
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	359 → 383	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	389 → 411	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	417 → 439	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous (PubMed:17097062). Highly expressed in brain, thymus and spleen (PubMed:17097062). {ECO:0000269|PubMed:17097062}.
• Sequence:

  MASSPAVDVSCRRREKRRQLDARRSKCRIRLGGHMEQWCLLKERLGFSLHSQLAKFLLDR
  YTSSGCVLCAGPEPLPPKGLQYLVLLSHAHSRECSLVPGLRGPGGQDGGLVWECSAGHTF
  SWGPSLSPTPSEAPKPASLPHTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPP
  PETFPPPGEEEGEEEEDNDEDEEEMLSDASLWTYSSSPDDSEPDAPRLLPSPVTCTPKEG
  ETPPAPAALSSPLAVPALSASSLSSRAPPPAEVRVQPQLSRTPQAAQQTEALASTGSQAQ
  SAPTPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFS
  CPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFCARSFRTSSNLVIHRRIHTGEKPLQCE
  ICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQE
  SPSGPLEPCPSISAPGPLGSSEGSRPSASPQAPTLLPQQ

• Sequence length: 519

Pathways

Reactome:

Generic Transcription Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
High myopia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinoma Hepatocellular	Associate	37980166	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Associate	37980166	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	37980166	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	37980166	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	38291502	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Stimulate	38291502	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	37980166	★☆☆☆☆ Found in Text Mining only