Gene Gene information from NCBI Gene database.
Entrez ID 55653
Gene name Breast carcinoma amplified sequence 4
Gene symbol BCAS4
Synonyms (NCBI Gene)
CNOL
Chromosome 20
Chromosome location 20q13.13
miRNA miRNA information provided by mirtarbase database.
336
miRTarBase ID miRNA Experiments Reference
MIRT023888 hsa-miR-1-3p Microarray 18668037
MIRT052089 hsa-let-7b-5p CLASH 23622248
MIRT692947 hsa-miR-340-3p HITS-CLIP 23313552
MIRT692946 hsa-miR-6827-3p HITS-CLIP 23313552
MIRT692945 hsa-miR-4684-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0031083 Component BLOC-1 complex IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607471 14367 ENSG00000124243
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TDM0
Protein name Breast carcinoma-amplified sequence 4
Family and domains
Tissue specificity TISSUE SPECIFICITY: Brain, thymus, spleen, kidney and placenta. Overexpressed in most breast cancer cell lines. {ECO:0000269|PubMed:12378525}.
Sequence
MQRTGGGAPRPGRNHGLPGSLRQPDPVALLMLLVDADQPEPMRSGARELALFLTPEPGAE
AKEVEETIEGMLLRLEEFCSLADLIRSDTSQILEENIPVLKAKLTEMRGIYAKVDRLEAF
VKMVGHHVAFLEADVLQAERDHGAFPQALRRWLGSAGLPSFRNVECSGTIPARCNLRLPG
SSDSPASASQVAGITEVTCTGARDVRAAHTV
Sequence length 211
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Lung cancer Benign rs188902261 RCV005910131
Malignant tumor of esophagus Benign rs188902261 RCV005910128
Sarcoma Benign rs188902261 RCV005910129
Uterine carcinosarcoma Benign rs188902261 RCV005910130
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 23036331, 24395524, 27506935, 37922300
Glioblastoma Associate 38150033
Glioma Associate 38150033
Head and Neck Neoplasms Associate 35460558
Lymphoma Follicular Associate 38150033