Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55653
Gene name Gene Name - the full gene name approved by the HGNC.
Breast carcinoma amplified sequence 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BCAS4
Synonyms (NCBI Gene) Gene synonyms aliases
CNOL
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.13
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023888 hsa-miR-1-3p Microarray 18668037
MIRT052089 hsa-let-7b-5p CLASH 23622248
MIRT692947 hsa-miR-340-3p HITS-CLIP 23313552
MIRT692946 hsa-miR-6827-3p HITS-CLIP 23313552
MIRT692945 hsa-miR-4684-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0031083 Component BLOC-1 complex IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607471 14367 ENSG00000124243
Protein
UniProt ID Q8TDM0
Protein name Breast carcinoma-amplified sequence 4
Family and domains
Tissue specificity TISSUE SPECIFICITY: Brain, thymus, spleen, kidney and placenta. Overexpressed in most breast cancer cell lines. {ECO:0000269|PubMed:12378525}.
Sequence
MQRTGGGAPRPGRNHGLPGSLRQPDPVALLMLLVDADQPEPMRSGARELALFLTPEPGAE
AKEVEETIEGMLLRLEEFCSLADLIRSDTSQILEENIPVLKAKLTEMRGIYAKVDRLEAF
VKMVGHHVAFLEADVLQAERDHGAFPQALRRWLGSAGLPSFRNVECSGTIPARCNLRLPG
SSDSPASASQVAGITEVTCTGARDVRAAHTV
Sequence length 211
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Carcinoma Basal cell carcinoma N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 23036331, 24395524, 27506935, 37922300
Glioblastoma Associate 38150033
Glioma Associate 38150033
Head and Neck Neoplasms Associate 35460558
Lymphoma Follicular Associate 38150033