Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55647
Gene name Gene Name - the full gene name approved by the HGNC.	RAB20, member RAS oncogene family
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RAB20
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q34

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments
MIRT1282366	hsa-miR-1299	CLIP-seq
MIRT1282367	hsa-miR-3148	CLIP-seq
MIRT1282368	hsa-miR-3166	CLIP-seq
MIRT1282369	hsa-miR-3665	CLIP-seq
MIRT1282370	hsa-miR-4771	CLIP-seq
MIRT1282371	hsa-miR-4782-5p	CLIP-seq
MIRT1282372	hsa-miR-502-5p	CLIP-seq
MIRT1282373	hsa-miR-516b	CLIP-seq
MIRT1282374	hsa-miR-616	CLIP-seq
MIRT1282375	hsa-miR-657	CLIP-seq
MIRT1282376	hsa-miR-764	CLIP-seq
MIRT1282377	hsa-miR-875-3p	CLIP-seq
MIRT2083588	hsa-miR-29a	CLIP-seq
MIRT2083589	hsa-miR-29b	CLIP-seq
MIRT2083590	hsa-miR-29c	CLIP-seq
MIRT2083591	hsa-miR-3663-3p	CLIP-seq
MIRT2083592	hsa-miR-4733-3p	CLIP-seq
MIRT2083593	hsa-miR-4781-5p	CLIP-seq
MIRT2083594	hsa-miR-486-3p	CLIP-seq
MIRT2083595	hsa-miR-744	CLIP-seq
MIRT2308802	hsa-miR-1224-3p	CLIP-seq
MIRT2308803	hsa-miR-1260	CLIP-seq
MIRT2308804	hsa-miR-1260b	CLIP-seq
MIRT2308805	hsa-miR-1280	CLIP-seq
MIRT2308806	hsa-miR-188-3p	CLIP-seq
MIRT2308807	hsa-miR-3149	CLIP-seq
MIRT2308808	hsa-miR-3156-3p	CLIP-seq
MIRT2308809	hsa-miR-3159	CLIP-seq
MIRT2308810	hsa-miR-3646	CLIP-seq
MIRT2308811	hsa-miR-4286	CLIP-seq
MIRT2308812	hsa-miR-568	CLIP-seq
MIRT2605790	hsa-miR-3150b-3p	CLIP-seq
MIRT2605791	hsa-miR-4499	CLIP-seq
MIRT2605792	hsa-miR-4689	CLIP-seq
MIRT2605793	hsa-miR-4784	CLIP-seq
MIRT2605794	hsa-miR-4786-5p	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006897	Process	Endocytosis	IBA
GO:0012505	Component	Endomembrane system	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030139	Component	Endocytic vesicle	IBA
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0045335	Component	Phagocytic vesicle	IDA	21255211
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0090383	Process	Phagosome acidification	IMP	21255211
GO:0090385	Process	Phagosome-lysosome fusion	IMP	21255211

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q9NX57

Protein name

Ras-related protein Rab-20 (EC 3.6.5.2)

Protein function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	7 → 202	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Low or absent expression in normal pancreas and stronger expression in 15 of 18 exocrine pancreatic adenocarcinomas (at protein level). {ECO:0000269|PubMed:16613320}.

Sequence

MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGRE
QFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEE
GALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCF
ETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA

Sequence length

234

Interactions

View interactions

	Reactome
			RAB geranylgeranylation

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Biliary Atresia	Biliary atresia	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenoma	Associate	21102417
Aneuploidy	Associate	21102417
Carcinoma Hepatocellular	Inhibit	34401050
Carotid Stenosis	Associate	31589004
HIV Infections	Associate	33692804
Leukemia B Cell	Associate	32138279
Leukemia Biphenotypic Acute	Associate	32138279
Myelodysplastic Syndromes	Associate	15147372
Neoplasm Metastasis	Associate	34401050
Neoplasms	Associate	21102417
Neoplasms Multiple Primary	Associate	21102417
ST Elevation Myocardial Infarction	Associate	31589004
Tuberculosis	Associate	33692804
Urinary Bladder Neoplasms	Associate	22724020

RAB20 (RAB20, member RAS oncogene family)