RAB20 (RAB20, member RAS oncogene family)

Gene

• Entrez ID: 55647
• Gene name: RAB20, member RAS oncogene family
• Gene symbol: RAB20
• Synonyms (NCBI Gene): -
• Chromosome: 13
• Chromosome location: 13q34

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1282366	hsa-miR-1299	CLIP-seq
MIRT1282367	hsa-miR-3148	CLIP-seq
MIRT1282368	hsa-miR-3166	CLIP-seq
MIRT1282369	hsa-miR-3665	CLIP-seq
MIRT1282370	hsa-miR-4771	CLIP-seq
MIRT1282371	hsa-miR-4782-5p	CLIP-seq
MIRT1282372	hsa-miR-502-5p	CLIP-seq
MIRT1282373	hsa-miR-516b	CLIP-seq
MIRT1282374	hsa-miR-616	CLIP-seq
MIRT1282375	hsa-miR-657	CLIP-seq
MIRT1282376	hsa-miR-764	CLIP-seq
MIRT1282377	hsa-miR-875-3p	CLIP-seq
MIRT2083588	hsa-miR-29a	CLIP-seq
MIRT2083589	hsa-miR-29b	CLIP-seq
MIRT2083590	hsa-miR-29c	CLIP-seq
MIRT2083591	hsa-miR-3663-3p	CLIP-seq
MIRT2083592	hsa-miR-4733-3p	CLIP-seq
MIRT2083593	hsa-miR-4781-5p	CLIP-seq
MIRT2083594	hsa-miR-486-3p	CLIP-seq
MIRT2083595	hsa-miR-744	CLIP-seq
MIRT2308802	hsa-miR-1224-3p	CLIP-seq
MIRT2308803	hsa-miR-1260	CLIP-seq
MIRT2308804	hsa-miR-1260b	CLIP-seq
MIRT2308805	hsa-miR-1280	CLIP-seq
MIRT2308806	hsa-miR-188-3p	CLIP-seq
MIRT2308807	hsa-miR-3149	CLIP-seq
MIRT2308808	hsa-miR-3156-3p	CLIP-seq
MIRT2308809	hsa-miR-3159	CLIP-seq
MIRT2308810	hsa-miR-3646	CLIP-seq
MIRT2308811	hsa-miR-4286	CLIP-seq
MIRT2308812	hsa-miR-568	CLIP-seq
MIRT2605790	hsa-miR-3150b-3p	CLIP-seq
MIRT2605791	hsa-miR-4499	CLIP-seq
MIRT2605792	hsa-miR-4689	CLIP-seq
MIRT2605793	hsa-miR-4784	CLIP-seq
MIRT2605794	hsa-miR-4786-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0005525	Function	GTP binding	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006886	Process	Intracellular protein transport	IBA	21873635
GO:0012505	Component	Endomembrane system	IBA	21873635
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0045335	Component	Phagocytic vesicle	IDA	21255211
GO:0071346	Process	Cellular response to interferon-gamma	IEA
GO:0090383	Process	Phagosome acidification	IMP	21255211
GO:0090385	Process	Phagosome-lysosome fusion	IMP	21255211

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9NX57
• Protein name: Ras-related protein Rab-20 (EC 3.6.5.2)
• Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	7 → 202	Ras family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Low or absent expression in normal pancreas and stronger expression in 15 of 18 exocrine pancreatic adenocarcinomas (at protein level). {ECO:0000269|PubMed:16613320}.
• Sequence:

  MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGRE
  QFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEE
  GALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCF
  ETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA

• Sequence length: 234

Pathways

Reactome:

RAB geranylgeranylation

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912, rs121917847, rs104893655, rs104893657, rs104893658, rs104893659, rs104893660, rs104893656, rs121917719, rs786204790, rs189261858, rs879255608, rs868197660, rs879255609, rs1586744173, rs1586182837, rs771222349, rs1587618417, rs1601844140, rs760832986, rs780982673, rs1603336347, rs1691155605	30595370
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Unknown
Disease term	Disease name	Evidence	References	Source
Oligodendroglioma	Oligodendroglioma			GWAS
Biliary Atresia	Biliary Atresia			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Adenoma	Associate	21102417
Aneuploidy	Associate	21102417
Carcinoma Hepatocellular	Inhibit	34401050
Carotid Stenosis	Associate	31589004
HIV Infections	Associate	33692804
Leukemia B Cell	Associate	32138279
Leukemia Biphenotypic Acute	Associate	32138279
Myelodysplastic Syndromes	Associate	15147372
Neoplasm Metastasis	Associate	34401050
Neoplasms	Associate	21102417
Neoplasms Multiple Primary	Associate	21102417
ST Elevation Myocardial Infarction	Associate	31589004
Tuberculosis	Associate	33692804
Urinary Bladder Neoplasms	Associate	22724020