Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55646
Gene name	Ly1 antibody reactive
Gene symbol	LYAR
Synonyms (NCBI Gene)	ZC2HC2ZLYAR
Chromosome	4
Chromosome location	4p16.3

Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031947	hsa-miR-16-5p	Proteomics	18668040
MIRT1123070	hsa-miR-3185	CLIP-seq
MIRT1123071	hsa-miR-4519	CLIP-seq
MIRT1123072	hsa-miR-488	CLIP-seq
MIRT1123073	hsa-miR-340	CLIP-seq
MIRT1123074	hsa-miR-3941	CLIP-seq
MIRT1123075	hsa-miR-4643	CLIP-seq
MIRT1123076	hsa-miR-466	CLIP-seq
MIRT1123077	hsa-miR-4672	CLIP-seq
MIRT1123078	hsa-miR-4760-3p	CLIP-seq
MIRT1123079	hsa-miR-4789-3p	CLIP-seq
MIRT1123080	hsa-miR-664	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	31413131
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	25092918
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0001750	Component	Photoreceptor outer segment	ISS
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IDA	25092918
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	21516116, 22720776, 25092918, 25416956, 30177828, 31515488, 32296183, 33961781, 34029587, 34578187, 36217029
GO:0005634	Component	Nucleus	IDA	22720776, 25092918
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	24495227, 31413131, 31504794
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006364	Process	RRNA processing	IBA
GO:0006364	Process	RRNA processing	IEA
GO:0006364	Process	RRNA processing	IMP	24495227
GO:0008270	Function	Zinc ion binding	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042995	Component	Cell projection	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045824	Process	Negative regulation of innate immune response	IDA	31413131
GO:0045943	Process	Positive regulation of transcription by RNA polymerase I	IDA	31504794
GO:0046872	Function	Metal ion binding	IEA
GO:0048821	Process	Erythrocyte development	IMP	25092918
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0140297	Function	DNA-binding transcription factor binding	IPI	31413131
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	31413131

MIM	HGNC	e!Ensembl
617684	26021	ENSG00000145220

Q9NX58

Protein name

Cell growth-regulating nucleolar protein

Protein function

Plays a role in the maintenance of the appropriate processing of 47S/45S pre-rRNA to 32S/30S pre-rRNAs and their subsequent processing to produce 18S and 28S rRNAs (PubMed:24495227). Also acts at the level of transcription regulation. Along with

PDB

6ZMI , 6ZMO , 6ZVH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17848	zf-ACC	3 → 28	Acetyl-coA carboxylase zinc finger domain	Domain
PF08790	zf-LYAR	31 → 58	LYAR-type C2HC zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in testis. {ECO:0000269|PubMed:24990247}.

Sequence

MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGG
KGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKN
SLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQ
QGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPE
ANGSAGKRSKKKKQRKDSASEEEAHVGAGKRKRRHSEVETDSKKKKMKLPEHPEGGEPED
DEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRSEEELLVIFNK
KISKNPTFKLLKDKVKLVK

Sequence length

379

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM ORIGIN VERTIGO	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VERTIGO	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VESTIBULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
beta Thalassemia	Associate	36614221	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	28686580, 31504794	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	34696677	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	33111744	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	26413750, 37604903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Influenza Human	Stimulate	30209172	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24912852, 26413750, 33111744, 34696677, 39369912	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	28686580	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	24961659	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency Chronic	Associate	35571562	★★★★★ ★☆☆☆☆ Found in Text Mining only

LYAR (Ly1 antibody reactive)