Gene Gene information from NCBI Gene database.
Entrez ID 5564
Gene name Protein kinase AMP-activated non-catalytic subunit beta 1
Gene symbol PRKAB1
Synonyms (NCBI Gene)
AMPKHAMPKb
Chromosome 12
Chromosome location 12q24.23
Summary The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
miRNA miRNA information provided by mirtarbase database.
405
miRTarBase ID miRNA Experiments Reference
MIRT004527 hsa-miR-122-5p Luciferase reporter assay 16459310
MIRT053237 hsa-miR-148b-3p ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 23171948
MIRT719926 hsa-miR-483-3p HITS-CLIP 19536157
MIRT719927 hsa-miR-4733-3p HITS-CLIP 19536157
MIRT719926 hsa-miR-483-3p HITS-CLIP 19536157
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
TP53 Unknown 12771025
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16306228, 17028174, 18403135, 18480843, 18624398, 20562859, 21072212, 21988832, 22363791, 23455922, 25686248, 25852190, 28514442, 28561066, 32296183, 32707033, 33961781, 35271311
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 9693118
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602740 9378 ENSG00000111725
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y478
Protein name 5'-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1) (AMPKb)
Protein function Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing p
PDB 4CFE , 4CFF , 4ZHX , 5EZV , 5ISO , 6B1U , 6C9F , 6C9G , 6C9H , 6C9J , 7MYJ , 8BIK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16561 AMPK1_CBM 78 161 Glycogen recognition site of AMP-activated protein kinase Family
PF04739 AMPKBI 199 269 Family
Sequence
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFE
VFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKP
I
Sequence length 270
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  FoxO signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Apelin signaling pathway
Tight junction
Circadian rhythm
Thermogenesis
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease
Alcoholic liver disease
Hypertrophic cardiomyopathy
  Macroautophagy
Energy dependent regulation of mTOR by LKB1-AMPK
TP53 Regulates Metabolic Genes
Regulation of TP53 Activity through Phosphorylation