STAP2 (signal transducing adaptor family member 2)

Gene

• Entrez ID: 55620
• Gene name: Signal transducing adaptor family member 2
• Gene symbol: STAP2
• Synonyms (NCBI Gene): BKS
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking pro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019827	hsa-miR-375	Microarray	20215506
MIRT1395041	hsa-miR-1343	CLIP-seq
MIRT1395042	hsa-miR-146b-3p	CLIP-seq
MIRT1395043	hsa-miR-186	CLIP-seq
MIRT1395044	hsa-miR-3126-3p	CLIP-seq
MIRT1395045	hsa-miR-3148	CLIP-seq
MIRT1395046	hsa-miR-3153	CLIP-seq
MIRT1395047	hsa-miR-3173-5p	CLIP-seq
MIRT1395048	hsa-miR-3176	CLIP-seq
MIRT1395049	hsa-miR-3199	CLIP-seq
MIRT1395050	hsa-miR-3922-3p	CLIP-seq
MIRT1395051	hsa-miR-3940-3p	CLIP-seq
MIRT1395052	hsa-miR-4281	CLIP-seq
MIRT1395053	hsa-miR-4292	CLIP-seq
MIRT1395054	hsa-miR-4640-5p	CLIP-seq
MIRT1395055	hsa-miR-4646-5p	CLIP-seq
MIRT1395056	hsa-miR-4668-5p	CLIP-seq
MIRT1395057	hsa-miR-4726-5p	CLIP-seq
MIRT1395058	hsa-miR-500a	CLIP-seq
MIRT1395059	hsa-miR-874	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16365431, 28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0035591	Function	Signaling adaptor activity	IEA

Other IDs

• MIM: 607881
• HGNC: 30430
• e!Ensembl: ENSG00000178078

Protein

• UniProt ID: Q9UGK3
• Protein name: Signal-transducing adaptor protein 2 (STAP-2) (Breast tumor kinase substrate) (BRK substrate)
• Protein function: Substrate of protein kinase PTK6. May play a regulatory role in the acute-phase response in systemic inflammation and may modulate STAT3 activity.
• PDB: 2EL8
• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10980601, ECO:0000269|PubMed:12540842}.
• Sequence:

  MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHV
  EKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELR
  VPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPS
  GDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKA
  LVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPL
  PPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPK
  VFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH

• Sequence length: 403

Pathways

Reactome:

PTK6 Activates STAT3

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	20929863, 21205088	★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Peripheral	Associate	34147695	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	31659097	★☆☆☆☆ Found in Text Mining only