Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55615
Gene name	Proline rich 5
Gene symbol	PRR5
Synonyms (NCBI Gene)	FLJ20185kPP610PROTOR-1PROTOR1
Chromosome	22
Chromosome location	22q13.31
Summary	This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. The protein is a component of the mammalian

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040726	hsa-miR-92b-3p	CLASH	23622248
MIRT035827	hsa-miR-1292-5p	CLASH	23622248
MIRT1267127	hsa-miR-223	CLIP-seq
MIRT1267128	hsa-miR-3922-5p	CLIP-seq
MIRT1267129	hsa-miR-4697-3p	CLIP-seq
MIRT1267130	hsa-miR-4753-5p	CLIP-seq
MIRT1267131	hsa-miR-548ac	CLIP-seq
MIRT1267132	hsa-miR-548ae	CLIP-seq
MIRT1267133	hsa-miR-548aj	CLIP-seq
MIRT1267134	hsa-miR-548am	CLIP-seq
MIRT1267135	hsa-miR-548d-3p	CLIP-seq
MIRT1267136	hsa-miR-548x	CLIP-seq
MIRT1267137	hsa-miR-548z	CLIP-seq
MIRT2304924	hsa-miR-3609	CLIP-seq
MIRT1267128	hsa-miR-3922-5p	CLIP-seq
MIRT1267130	hsa-miR-4753-5p	CLIP-seq
MIRT2304925	hsa-miR-520d-5p	CLIP-seq
MIRT2304926	hsa-miR-520g	CLIP-seq
MIRT2304927	hsa-miR-520h	CLIP-seq
MIRT2304928	hsa-miR-524-5p	CLIP-seq
MIRT2304929	hsa-miR-548ah	CLIP-seq
MIRT2601911	hsa-miR-3158-3p	CLIP-seq
MIRT2304924	hsa-miR-3609	CLIP-seq
MIRT2601912	hsa-miR-3661	CLIP-seq
MIRT1267128	hsa-miR-3922-5p	CLIP-seq
MIRT2601913	hsa-miR-3929	CLIP-seq
MIRT2601914	hsa-miR-4419b	CLIP-seq
MIRT2601915	hsa-miR-4446-3p	CLIP-seq
MIRT2601916	hsa-miR-4476	CLIP-seq
MIRT2601917	hsa-miR-4478	CLIP-seq
MIRT2601918	hsa-miR-4492	CLIP-seq
MIRT2601919	hsa-miR-4498	CLIP-seq
MIRT1267130	hsa-miR-4753-5p	CLIP-seq
MIRT2601920	hsa-miR-494	CLIP-seq
MIRT2304925	hsa-miR-520d-5p	CLIP-seq
MIRT2304926	hsa-miR-520g	CLIP-seq
MIRT2304927	hsa-miR-520h	CLIP-seq
MIRT2304928	hsa-miR-524-5p	CLIP-seq
MIRT2304929	hsa-miR-548ah	CLIP-seq
MIRT2601921	hsa-miR-631	CLIP-seq
MIRT2601922	hsa-miR-762	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	24550280, 28514442, 30126976, 32296183, 33961781, 36931259
GO:0005829	Component	Cytosol	TAS
GO:0007010	Process	Cytoskeleton organization	NAS	15268862
GO:0030307	Process	Positive regulation of cell growth	NAS	22500797
GO:0031669	Process	Cellular response to nutrient levels	NAS	22500797
GO:0031932	Component	TORC2 complex	IBA
GO:0031932	Component	TORC2 complex	IDA	22609986
GO:0031932	Component	TORC2 complex	IPI	17461779
GO:0038203	Process	TORC2 signaling	IBA
GO:0043066	Process	Negative regulation of apoptotic process	NAS	22500797
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA

MIM	HGNC	e!Ensembl
609406	31682	ENSG00000186654

P85299

Protein name

Proline-rich protein 5 (Protein observed with Rictor-1) (Protor-1)

Protein function

Associated subunit of mTORC2, which regulates cell growth and survival in response to hormonal signals (PubMed:17461779, PubMed:17599906, PubMed:29424687). mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08539	HbrB	37 → 147	HbrB-like	Domain

Tissue specificity

TISSUE SPECIFICITY: Most abundant in kidney and liver. Also highly expressed in brain, spleen, testis and placenta. Overexpressed in several colorectal tumors. {ECO:0000269|PubMed:15718101, ECO:0000269|PubMed:17599906}.

Sequence

MRTLRRLKFMSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLP
DQELFSLNEGVRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWD
FFFSDVLPMLQAIFYPVQGKEPSVRQLALLHFRNAITLSVKLEDALARAHARVPPAIVQM
LLVLQGVHESRGVTEDYLRLETLVQKVVSPYLGTYGLHSSEGPFTHSCILEKRLLRRSRS
GDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSCPEPQGFSDPPG
QGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTRSSLPRSSPENLVDQILESVDSDS
EGIFIDFGRGRGSGMSDLEGSGGRQSVV

Sequence length

388

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway		PIP3 activates AKT signaling CD28 dependent PI3K/Akt signaling VEGFR2 mediated vascular permeability Constitutive Signaling by AKT1 E17K in Cancer Regulation of TP53 Degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Bipolar Disorder	Associate	29391396	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	17599906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	17599906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	36269860	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRR5 (proline rich 5)