Gene Gene information from NCBI Gene database.
Entrez ID 5558
Gene name DNA primase subunit 2
Gene symbol PRIM2
Synonyms (NCBI Gene)
PRIM2Ap58
Chromosome 6
Chromosome location 6p11.2
Summary This gene encodes the 58 kilodalton subunit of DNA primase, an enzyme that plays a key role in the replication of DNA. The encoded protein forms a heterodimer with a 49 kilodalton subunit. This heterodimer functions as a DNA-directed RNA polymerase to syn
miRNA miRNA information provided by mirtarbase database.
161
miRTarBase ID miRNA Experiments Reference
MIRT680537 hsa-miR-890 HITS-CLIP 23706177
MIRT680536 hsa-miR-4695-5p HITS-CLIP 23706177
MIRT680535 hsa-miR-4779 HITS-CLIP 23706177
MIRT680534 hsa-miR-3929 HITS-CLIP 23706177
MIRT680533 hsa-miR-4419b HITS-CLIP 23706177
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003899 Function DNA-directed RNA polymerase activity IMP 25550159
GO:0005515 Function Protein binding IPI 20643958, 28514442, 32296183, 32814053, 33961781
GO:0005654 Component Nucleoplasm TAS
GO:0005658 Component Alpha DNA polymerase:primase complex IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
176636 9370 ENSG00000146143
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P49643
Protein name DNA primase large subunit (DNA primase 58 kDa subunit) (p58)
Protein function Regulatory subunit of the DNA primase complex and component of the DNA polymerase alpha complex (also known as the alpha DNA polymerase-primase complex) which play an essential role in the initiation of DNA synthesis (PubMed:17893144, PubMed:255
PDB 3L9Q , 3Q36 , 4BPU , 4BPW , 4BPX , 4RR2 , 5DQO , 5EXR , 5F0Q , 5F0S , 5I7M , 6DHW , 7OPL , 7U5C , 8B9D , 8D0B , 8D0K , 8D96 , 8D9D , 8QJ7 , 8VY3 , 9C8V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04104 DNA_primase_lrg 182 448 Eukaryotic and archaeal DNA primase, large subunit Family
Sequence
MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLG
VSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWF
IQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGF
ESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLSTKSFPPCMRQLHKALRENHH
LRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRT
DYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHY
QVACQKYFEMIHNVDDCGFSLNHPNQFF
CESQRILNGGKDIKKEPIQPETPQPKPSVQKT
KDASSALASLNSSLEMDMEGLEDYFSEDS
Sequence length 509
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  DNA replication   Inhibition of replication initiation of damaged DNA by RB1/E2F1
Polymerase switching on the C-strand of the telomere
Telomere C-strand synthesis initiation
DNA replication initiation
Activation of the pre-replicative complex
Polymerase switching
Removal of the Flap Intermediate
Processive synthesis on the lagging strand