Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5558
Gene name Gene Name - the full gene name approved by the HGNC.	DNA primase subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRIM2
Synonyms (NCBI Gene) Gene synonyms aliases	PRIM2A, p58
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the 58 kilodalton subunit of DNA primase, an enzyme that plays a key role in the replication of DNA. The encoded protein forms a heterodimer with a 49 kilodalton subunit. This heterodimer functions as a DNA-directed RNA polymerase to syn

Show/Hide all(161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT680537	hsa-miR-890	HITS-CLIP	23706177
MIRT680536	hsa-miR-4695-5p	HITS-CLIP	23706177
MIRT680535	hsa-miR-4779	HITS-CLIP	23706177
MIRT680534	hsa-miR-3929	HITS-CLIP	23706177
MIRT680533	hsa-miR-4419b	HITS-CLIP	23706177
MIRT680532	hsa-miR-4478	HITS-CLIP	23706177
MIRT680531	hsa-miR-3614-5p	HITS-CLIP	23706177
MIRT680530	hsa-miR-6500-3p	HITS-CLIP	23706177
MIRT680529	hsa-miR-7162-3p	HITS-CLIP	23706177
MIRT680528	hsa-miR-3160-3p	HITS-CLIP	23706177
MIRT680527	hsa-miR-558	HITS-CLIP	23706177
MIRT680526	hsa-miR-4487	HITS-CLIP	23706177
MIRT680525	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT680524	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT680523	hsa-let-7a-5p	HITS-CLIP	23706177
MIRT680522	hsa-let-7b-5p	HITS-CLIP	23706177
MIRT680521	hsa-let-7c-5p	HITS-CLIP	23706177
MIRT680520	hsa-let-7d-5p	HITS-CLIP	23706177
MIRT680519	hsa-let-7e-5p	HITS-CLIP	23706177
MIRT680518	hsa-let-7f-5p	HITS-CLIP	23706177
MIRT680517	hsa-let-7g-5p	HITS-CLIP	23706177
MIRT680516	hsa-let-7i-5p	HITS-CLIP	23706177
MIRT680515	hsa-miR-4458	HITS-CLIP	23706177
MIRT680514	hsa-miR-4500	HITS-CLIP	23706177
MIRT680513	hsa-miR-98-5p	HITS-CLIP	23706177
MIRT680512	hsa-miR-202-3p	HITS-CLIP	23706177
MIRT680511	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT680510	hsa-miR-6894-5p	HITS-CLIP	23706177
MIRT680509	hsa-miR-7106-5p	HITS-CLIP	23706177
MIRT680508	hsa-miR-149-3p	HITS-CLIP	23706177
MIRT680507	hsa-miR-4728-5p	HITS-CLIP	23706177
MIRT680506	hsa-miR-6785-5p	HITS-CLIP	23706177
MIRT680505	hsa-miR-6883-5p	HITS-CLIP	23706177
MIRT680504	hsa-miR-6799-5p	HITS-CLIP	23706177
MIRT680503	hsa-miR-4266	HITS-CLIP	23706177
MIRT680502	hsa-miR-30c-1-3p	HITS-CLIP	23706177
MIRT680501	hsa-miR-30c-2-3p	HITS-CLIP	23706177
MIRT680500	hsa-miR-6788-5p	HITS-CLIP	23706177
MIRT680499	hsa-miR-1273h-5p	HITS-CLIP	23706177
MIRT680498	hsa-miR-30b-3p	HITS-CLIP	23706177
MIRT680497	hsa-miR-3689a-3p	HITS-CLIP	23706177
MIRT680496	hsa-miR-3689b-3p	HITS-CLIP	23706177
MIRT680495	hsa-miR-3689c	HITS-CLIP	23706177
MIRT680494	hsa-miR-6779-5p	HITS-CLIP	23706177
MIRT680493	hsa-miR-6780a-5p	HITS-CLIP	23706177
MIRT680492	hsa-miR-887-5p	HITS-CLIP	23706177
MIRT680491	hsa-miR-665	HITS-CLIP	23706177
MIRT680537	hsa-miR-890	HITS-CLIP	23706177
MIRT680536	hsa-miR-4695-5p	HITS-CLIP	23706177
MIRT680535	hsa-miR-4779	HITS-CLIP	23706177
MIRT680534	hsa-miR-3929	HITS-CLIP	23706177
MIRT680533	hsa-miR-4419b	HITS-CLIP	23706177
MIRT680532	hsa-miR-4478	HITS-CLIP	23706177
MIRT680531	hsa-miR-3614-5p	HITS-CLIP	23706177
MIRT680530	hsa-miR-6500-3p	HITS-CLIP	23706177
MIRT680529	hsa-miR-7162-3p	HITS-CLIP	23706177
MIRT680528	hsa-miR-3160-3p	HITS-CLIP	23706177
MIRT680527	hsa-miR-558	HITS-CLIP	23706177
MIRT680526	hsa-miR-4487	HITS-CLIP	23706177
MIRT680525	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT680524	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT680523	hsa-let-7a-5p	HITS-CLIP	23706177
MIRT680522	hsa-let-7b-5p	HITS-CLIP	23706177
MIRT680521	hsa-let-7c-5p	HITS-CLIP	23706177
MIRT680520	hsa-let-7d-5p	HITS-CLIP	23706177
MIRT680519	hsa-let-7e-5p	HITS-CLIP	23706177
MIRT680518	hsa-let-7f-5p	HITS-CLIP	23706177
MIRT680517	hsa-let-7g-5p	HITS-CLIP	23706177
MIRT680516	hsa-let-7i-5p	HITS-CLIP	23706177
MIRT680515	hsa-miR-4458	HITS-CLIP	23706177
MIRT680514	hsa-miR-4500	HITS-CLIP	23706177
MIRT680513	hsa-miR-98-5p	HITS-CLIP	23706177
MIRT680512	hsa-miR-202-3p	HITS-CLIP	23706177
MIRT680511	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT680510	hsa-miR-6894-5p	HITS-CLIP	23706177
MIRT680509	hsa-miR-7106-5p	HITS-CLIP	23706177
MIRT680508	hsa-miR-149-3p	HITS-CLIP	23706177
MIRT680507	hsa-miR-4728-5p	HITS-CLIP	23706177
MIRT680506	hsa-miR-6785-5p	HITS-CLIP	23706177
MIRT680505	hsa-miR-6883-5p	HITS-CLIP	23706177
MIRT680504	hsa-miR-6799-5p	HITS-CLIP	23706177
MIRT680503	hsa-miR-4266	HITS-CLIP	23706177
MIRT680502	hsa-miR-30c-1-3p	HITS-CLIP	23706177
MIRT680501	hsa-miR-30c-2-3p	HITS-CLIP	23706177
MIRT680500	hsa-miR-6788-5p	HITS-CLIP	23706177
MIRT680499	hsa-miR-1273h-5p	HITS-CLIP	23706177
MIRT680498	hsa-miR-30b-3p	HITS-CLIP	23706177
MIRT680497	hsa-miR-3689a-3p	HITS-CLIP	23706177
MIRT680496	hsa-miR-3689b-3p	HITS-CLIP	23706177
MIRT680495	hsa-miR-3689c	HITS-CLIP	23706177
MIRT680494	hsa-miR-6779-5p	HITS-CLIP	23706177
MIRT680493	hsa-miR-6780a-5p	HITS-CLIP	23706177
MIRT680492	hsa-miR-887-5p	HITS-CLIP	23706177
MIRT680491	hsa-miR-665	HITS-CLIP	23706177
MIRT1261655	hsa-let-7a	CLIP-seq
MIRT1261656	hsa-let-7b	CLIP-seq
MIRT1261657	hsa-let-7c	CLIP-seq
MIRT1261658	hsa-let-7d	CLIP-seq
MIRT1261659	hsa-let-7e	CLIP-seq
MIRT1261660	hsa-let-7f	CLIP-seq
MIRT1261661	hsa-let-7g	CLIP-seq
MIRT1261662	hsa-let-7i	CLIP-seq
MIRT1261663	hsa-miR-1321	CLIP-seq
MIRT1261664	hsa-miR-202	CLIP-seq
MIRT1261665	hsa-miR-3162-5p	CLIP-seq
MIRT1261666	hsa-miR-4281	CLIP-seq
MIRT1261667	hsa-miR-4739	CLIP-seq
MIRT1261668	hsa-miR-4756-5p	CLIP-seq
MIRT1261669	hsa-miR-606	CLIP-seq
MIRT1261670	hsa-miR-98	CLIP-seq
MIRT1261655	hsa-let-7a	CLIP-seq
MIRT1261656	hsa-let-7b	CLIP-seq
MIRT1261657	hsa-let-7c	CLIP-seq
MIRT1261658	hsa-let-7d	CLIP-seq
MIRT1261659	hsa-let-7e	CLIP-seq
MIRT1261660	hsa-let-7f	CLIP-seq
MIRT1261661	hsa-let-7g	CLIP-seq
MIRT1261662	hsa-let-7i	CLIP-seq
MIRT1261664	hsa-miR-202	CLIP-seq
MIRT2077071	hsa-miR-3192	CLIP-seq
MIRT2077072	hsa-miR-326	CLIP-seq
MIRT2077073	hsa-miR-330-5p	CLIP-seq
MIRT1261666	hsa-miR-4281	CLIP-seq
MIRT2077074	hsa-miR-4314	CLIP-seq
MIRT2077075	hsa-miR-4646-5p	CLIP-seq
MIRT1261669	hsa-miR-606	CLIP-seq
MIRT1261670	hsa-miR-98	CLIP-seq
MIRT2303568	hsa-miR-1185	CLIP-seq
MIRT2303569	hsa-miR-1294	CLIP-seq
MIRT2077071	hsa-miR-3192	CLIP-seq
MIRT2077072	hsa-miR-326	CLIP-seq
MIRT2077073	hsa-miR-330-5p	CLIP-seq
MIRT2303570	hsa-miR-3605-5p	CLIP-seq
MIRT2303571	hsa-miR-3679-5p	CLIP-seq
MIRT2303572	hsa-miR-4261	CLIP-seq
MIRT2077074	hsa-miR-4314	CLIP-seq
MIRT2303573	hsa-miR-4316	CLIP-seq
MIRT2303574	hsa-miR-4438	CLIP-seq
MIRT2303575	hsa-miR-4496	CLIP-seq
MIRT2077075	hsa-miR-4646-5p	CLIP-seq
MIRT2303576	hsa-miR-548ac	CLIP-seq
MIRT2303577	hsa-miR-548ae	CLIP-seq
MIRT2303578	hsa-miR-548aj	CLIP-seq
MIRT2303579	hsa-miR-548am	CLIP-seq
MIRT2303580	hsa-miR-548d-3p	CLIP-seq
MIRT2303581	hsa-miR-548x	CLIP-seq
MIRT2303582	hsa-miR-548z	CLIP-seq
MIRT2392958	hsa-miR-24	CLIP-seq
MIRT2392959	hsa-miR-4284	CLIP-seq
MIRT2077071	hsa-miR-3192	CLIP-seq
MIRT2077072	hsa-miR-326	CLIP-seq
MIRT2077073	hsa-miR-330-5p	CLIP-seq
MIRT2077074	hsa-miR-4314	CLIP-seq
MIRT2077075	hsa-miR-4646-5p	CLIP-seq
MIRT2303569	hsa-miR-1294	CLIP-seq
MIRT2077071	hsa-miR-3192	CLIP-seq
MIRT2077072	hsa-miR-326	CLIP-seq
MIRT2077073	hsa-miR-330-5p	CLIP-seq
MIRT2077074	hsa-miR-4314	CLIP-seq
MIRT2303573	hsa-miR-4316	CLIP-seq
MIRT2077075	hsa-miR-4646-5p	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	IMP	25550159
GO:0005515	Function	Protein binding	IPI	20643958, 28514442, 32296183, 32814053, 33961781
GO:0005654	Component	Nucleoplasm	TAS
GO:0005658	Component	Alpha DNA polymerase:primase complex	IBA
GO:0005658	Component	Alpha DNA polymerase:primase complex	IDA	8026492, 26975377
GO:0005658	Component	Alpha DNA polymerase:primase complex	IEA
GO:0005658	Component	Alpha DNA polymerase:primase complex	IPI	26975377
GO:0006260	Process	DNA replication	IEA
GO:0006269	Process	DNA replication, synthesis of primer	IBA
GO:0006269	Process	DNA replication, synthesis of primer	IDA	8026492
GO:0006269	Process	DNA replication, synthesis of primer	IEA
GO:0006269	Process	DNA replication, synthesis of primer	ISS
GO:0006270	Process	DNA replication initiation	IBA
GO:0006270	Process	DNA replication initiation	IDA	26975377
GO:0006270	Process	DNA replication initiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051536	Function	Iron-sulfur cluster binding	IEA
GO:0051539	Function	4 iron, 4 sulfur cluster binding	IDA	25550159, 26975377
GO:0051539	Function	4 iron, 4 sulfur cluster binding	IEA
GO:0071667	Function	DNA/RNA hybrid binding	IDA	26975377

MIM	HGNC	e!Ensembl
176636	9370	ENSG00000146143

Protein

UniProt ID

P49643

Protein name

DNA primase large subunit (DNA primase 58 kDa subunit) (p58)

Protein function

Regulatory subunit of the DNA primase complex and component of the DNA polymerase alpha complex (also known as the alpha DNA polymerase-primase complex) which play an essential role in the initiation of DNA synthesis (PubMed:17893144, PubMed:255

PDB

3L9Q , 3Q36 , 4BPU , 4BPW , 4BPX , 4RR2 , 5DQO , 5EXR , 5F0Q , 5F0S , 5I7M , 6DHW , 7OPL , 7U5C , 8B9D , 8D0B , 8D0K , 8D96 , 8D9D , 8QJ7 , 8VY3 , 9C8V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04104	DNA_primase_lrg	182 → 448	Eukaryotic and archaeal DNA primase, large subunit	Family

Sequence

MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLG
VSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWF
IQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGF
ESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLSTKSFPPCMRQLHKALRENHH
LRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRT
DYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHY
QVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILNGGKDIKKEPIQPETPQPKPSVQKT
KDASSALASLNSSLEMDMEGLEDYFSEDS

Sequence length

509

Interactions

View interactions

	KEGG		Reactome
	DNA replication		Inhibition of replication initiation of damaged DNA by RB1/E2F1 Polymerase switching on the C-strand of the telomere Telomere C-strand synthesis initiation DNA replication initiation Activation of the pre-replicative complex Polymerase switching Removal of the Flap Intermediate Processive synthesis on the lagging strand

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Non Small Cell Lung	Associate	34058013
Colorectal Neoplasms	Associate	34573430
Glioma	Associate	38423596
Hypertension Pulmonary	Associate	31248429
Neoplasms	Associate	31248429, 34573430, 38423596
Obesity	Associate	27421018
Personality Disorders	Associate	38423596
Sleep Initiation and Maintenance Disorders	Associate	32648482

PRIM2 (DNA primase subunit 2)