Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5558
Gene name Gene Name - the full gene name approved by the HGNC.
DNA primase subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRIM2
Synonyms (NCBI Gene) Gene synonyms aliases
PRIM2A, p58
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the 58 kilodalton subunit of DNA primase, an enzyme that plays a key role in the replication of DNA. The encoded protein forms a heterodimer with a 49 kilodalton subunit. This heterodimer functions as a DNA-directed RNA polymerase to syn
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT680537 hsa-miR-890 HITS-CLIP 23706177
MIRT680536 hsa-miR-4695-5p HITS-CLIP 23706177
MIRT680535 hsa-miR-4779 HITS-CLIP 23706177
MIRT680534 hsa-miR-3929 HITS-CLIP 23706177
MIRT680533 hsa-miR-4419b HITS-CLIP 23706177
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003899 Function DNA-directed RNA polymerase activity IMP 25550159
GO:0005515 Function Protein binding IPI 20643958, 28514442, 32296183, 32814053, 33961781
GO:0005654 Component Nucleoplasm TAS
GO:0005658 Component Alpha DNA polymerase:primase complex IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
176636 9370 ENSG00000146143
Protein
UniProt ID P49643
Protein name DNA primase large subunit (DNA primase 58 kDa subunit) (p58)
Protein function Regulatory subunit of the DNA primase complex and component of the DNA polymerase alpha complex (also known as the alpha DNA polymerase-primase complex) which play an essential role in the initiation of DNA synthesis (PubMed:17893144, PubMed:255
PDB 3L9Q , 3Q36 , 4BPU , 4BPW , 4BPX , 4RR2 , 5DQO , 5EXR , 5F0Q , 5F0S , 5I7M , 6DHW , 7OPL , 7U5C , 8B9D , 8D0B , 8D0K , 8D96 , 8D9D , 8QJ7 , 8VY3 , 9C8V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04104 DNA_primase_lrg 182 448 Eukaryotic and archaeal DNA primase, large subunit Family
Sequence
MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLG
VSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWF
IQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGF
ESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLSTKSFPPCMRQLHKALRENHH
LRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRT
DYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHY
QVACQKYFEMIHNVDDCGFSLNHPNQFF
CESQRILNGGKDIKKEPIQPETPQPKPSVQKT
KDASSALASLNSSLEMDMEGLEDYFSEDS
Sequence length 509
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  DNA replication   Inhibition of replication initiation of damaged DNA by RB1/E2F1
Polymerase switching on the C-strand of the telomere
Telomere C-strand synthesis initiation
DNA replication initiation
Activation of the pre-replicative complex
Polymerase switching
Removal of the Flap Intermediate
Processive synthesis on the lagging strand
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Non Small Cell Lung Associate 34058013
Colorectal Neoplasms Associate 34573430
Glioma Associate 38423596
Hypertension Pulmonary Associate 31248429
Neoplasms Associate 31248429, 34573430, 38423596
Obesity Associate 27421018
Personality Disorders Associate 38423596
Sleep Initiation and Maintenance Disorders Associate 32648482