Gene Gene information from NCBI Gene database.
Entrez ID 55568
Gene name Polypeptide N-acetylgalactosaminyltransferase 10
Gene symbol GALNT10
Synonyms (NCBI Gene)
GALNACT10PPGALNACT10PPGANTASE10
Chromosome 5
Chromosome location 5q33.2
Summary This gene encodes a member of the GalNAc polypeptide N-acetylgalactosaminyltransferases. These enzymes catalyze the first step in the synthesis of mucin-type oligosaccharides. These proteins transfer GalNAc from UDP-GalNAc to either serine or threonine re
miRNA miRNA information provided by mirtarbase database.
922
miRTarBase ID miRNA Experiments Reference
MIRT003102 hsa-miR-122-5p Luciferase reporter assayqRT-PCR 19296470
MIRT714575 hsa-miR-216b-3p HITS-CLIP 19536157
MIRT714574 hsa-miR-6892-3p HITS-CLIP 19536157
MIRT714573 hsa-miR-2276-5p HITS-CLIP 19536157
MIRT714572 hsa-miR-3183 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0004653 Function Polypeptide N-acetylgalactosaminyltransferase activity IBA
GO:0004653 Function Polypeptide N-acetylgalactosaminyltransferase activity IDA 12417297, 18562306, 19460755
GO:0004653 Function Polypeptide N-acetylgalactosaminyltransferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608043 19873 ENSG00000164574
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86SR1
Protein name Polypeptide N-acetylgalactosaminyltransferase 10 (EC 2.4.1.41) (Polypeptide GalNAc transferase 10) (GalNAc-T10) (pp-GaNTase 10) (Protein-UDP acetylgalactosaminyltransferase 10) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10)
Protein function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has activity toward Muc5Ac and EA2 peptide substrates.
PDB 2D7I , 2D7R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00535 Glycos_transf_2 148 333 Glycosyl transferase family 2 Family
PF00652 Ricin_B_lectin 459 587 Ricin-type beta-trefoil lectin domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at high level in small intestine, and at intermediate levels in stomach, pancreas, ovary, thyroid gland and spleen. Weakly expressed in other tissues. {ECO:0000269|PubMed:12417297}.
Sequence
MRRKEKRLLQAVALVLAALVLLPNVGLWALYRERQPDGTPGGSGAAVAPAAGQGSHSRQK
KTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDK
ISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEI
VLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHC
EANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIP
PELQKADPSDPFESPVMAGGLFAVDRKWFWELG
GYDPGLEIWGGEQYEISFKVWMCGGRM
EDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDV
AVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALG
SPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHS
MKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQW
LFEHTNSTVLEKF
NRN
Sequence length 603
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Mucin type O-glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
  O-linked glycosylation of mucins
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign; Likely benign rs57541779 RCV005909280
Familial cancer of breast Benign; Likely benign rs57541779 RCV005909279
GALNT10-related disorder Likely benign rs142666444 RCV003939534
Ovarian serous cystadenocarcinoma Benign; Likely benign rs57541779 RCV005909281
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 25422324
Cholangiocarcinoma Associate 33301605
Lymphatic Metastasis Stimulate 33275228
Neoplasms Associate 25551281, 31853576
Neoplasms Adipose Tissue Associate 21701570
Ovarian Neoplasms Associate 25551281, 31853576, 34111434
Stomach Neoplasms Associate 33275228