KLK15 (kallikrein related peptidase 15)

Gene

• Entrez ID: 55554
• Gene name: Kallikrein related peptidase 15
• Gene symbol: KLK15
• Synonyms (NCBI Gene): ACO, HSRNASPH
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1099020	hsa-miR-4264	CLIP-seq
MIRT1099021	hsa-miR-4488	CLIP-seq
MIRT1099022	hsa-miR-4688	CLIP-seq
MIRT1099023	hsa-miR-4697-5p	CLIP-seq
MIRT1099024	hsa-miR-4704-3p	CLIP-seq
MIRT1099025	hsa-miR-767-3p	CLIP-seq
MIRT1099026	hsa-miR-1256	CLIP-seq
MIRT1099027	hsa-miR-4642	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	11010966
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	8018728
GO:0016787	Function	Hydrolase activity	IEA
GO:0030141	Component	Secretory granule	IBA
GO:0051604	Process	Protein maturation	IBA

Other IDs

• MIM: 610601
• HGNC: 20453
• e!Ensembl: ENSG00000174562

Protein

• UniProt ID: Q9H2R5
• Protein name: Kallikrein-15 (EC 3.4.21.-) (ACO protease)
• Protein function: Protease whose physiological substrate is not yet known.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	22 → 249	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest expression in the thyroid gland. Also expressed in the prostate, salivary, and adrenal glands and in the colon testis and kidney. {ECO:0000269|PubMed:11010966}.
• Sequence:

  MWLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSA
  AHCQSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNP
  QVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSC
  DKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYT
  KVCHYLEWIRETMKRN

• Sequence length: 256