Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5552
Gene name	Serglycin
Gene symbol	SRGN
Synonyms (NCBI Gene)	PPGPRGPRG1
Chromosome	10
Chromosome location	10q22.1
Summary	This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydroly

153

Show/Hide all (153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028982	hsa-miR-26b-5p	Microarray	19088304
MIRT372958	hsa-miR-4761-5p	PAR-CLIP	23592263
MIRT372955	hsa-miR-4317	PAR-CLIP	23592263
MIRT372960	hsa-miR-7978	PAR-CLIP	23592263
MIRT372950	hsa-miR-1254	PAR-CLIP	23592263
MIRT372952	hsa-miR-3116	PAR-CLIP	23592263
MIRT372949	hsa-miR-661	PAR-CLIP	23592263
MIRT491418	hsa-miR-6894-3p	PAR-CLIP	23592263
MIRT491417	hsa-miR-6514-3p	PAR-CLIP	23592263
MIRT726459	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT726458	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT726457	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT726456	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT372958	hsa-miR-4761-5p	PAR-CLIP	23592263
MIRT372955	hsa-miR-4317	PAR-CLIP	23592263
MIRT372960	hsa-miR-7978	PAR-CLIP	23592263
MIRT372950	hsa-miR-1254	PAR-CLIP	23592263
MIRT372952	hsa-miR-3116	PAR-CLIP	23592263
MIRT372949	hsa-miR-661	PAR-CLIP	23592263
MIRT491418	hsa-miR-6894-3p	PAR-CLIP	23592263
MIRT491417	hsa-miR-6514-3p	PAR-CLIP	23592263
MIRT1388982	hsa-miR-1305	CLIP-seq
MIRT1388983	hsa-miR-181a	CLIP-seq
MIRT1388984	hsa-miR-181b	CLIP-seq
MIRT1388985	hsa-miR-181c	CLIP-seq
MIRT1388986	hsa-miR-181d	CLIP-seq
MIRT1388987	hsa-miR-3143	CLIP-seq
MIRT1388988	hsa-miR-3613-3p	CLIP-seq
MIRT1388989	hsa-miR-3647-3p	CLIP-seq
MIRT1388990	hsa-miR-3665	CLIP-seq
MIRT1388991	hsa-miR-4262	CLIP-seq
MIRT1388992	hsa-miR-4672	CLIP-seq
MIRT1388993	hsa-miR-4678	CLIP-seq
MIRT1388994	hsa-miR-498	CLIP-seq
MIRT1388995	hsa-miR-543	CLIP-seq
MIRT1388996	hsa-miR-548ag	CLIP-seq
MIRT1388997	hsa-miR-548ai	CLIP-seq
MIRT1388998	hsa-miR-548m	CLIP-seq
MIRT1388999	hsa-miR-633	CLIP-seq
MIRT1389000	hsa-miR-657	CLIP-seq
MIRT1389001	hsa-miR-802	CLIP-seq
MIRT1554154	hsa-miR-2277-3p	CLIP-seq
MIRT1554155	hsa-miR-4775	CLIP-seq
MIRT1554156	hsa-miR-892a	CLIP-seq
MIRT1557126	hsa-miR-1245b-3p	CLIP-seq
MIRT1557127	hsa-miR-3163	CLIP-seq
MIRT1557128	hsa-miR-3942-3p	CLIP-seq
MIRT1557129	hsa-miR-4282	CLIP-seq
MIRT1557130	hsa-miR-4310	CLIP-seq
MIRT1557131	hsa-miR-4422	CLIP-seq
MIRT1557132	hsa-miR-513a-3p	CLIP-seq
MIRT1557133	hsa-miR-548c-3p	CLIP-seq
MIRT2116610	hsa-miR-4528	CLIP-seq
MIRT2460545	hsa-miR-544	CLIP-seq
MIRT2460546	hsa-miR-889	CLIP-seq
MIRT2632548	hsa-miR-10a	CLIP-seq
MIRT2632549	hsa-miR-10b	CLIP-seq
MIRT2632550	hsa-miR-1208	CLIP-seq
MIRT2632551	hsa-miR-1283	CLIP-seq
MIRT1388982	hsa-miR-1305	CLIP-seq
MIRT1388983	hsa-miR-181a	CLIP-seq
MIRT1388984	hsa-miR-181b	CLIP-seq
MIRT1388985	hsa-miR-181c	CLIP-seq
MIRT1388986	hsa-miR-181d	CLIP-seq
MIRT2632552	hsa-miR-2276	CLIP-seq
MIRT2632553	hsa-miR-3121-3p	CLIP-seq
MIRT1557127	hsa-miR-3163	CLIP-seq
MIRT2632554	hsa-miR-3194-3p	CLIP-seq
MIRT2632555	hsa-miR-3607-3p	CLIP-seq
MIRT1388988	hsa-miR-3613-3p	CLIP-seq
MIRT2632556	hsa-miR-3620	CLIP-seq
MIRT2632557	hsa-miR-3653	CLIP-seq
MIRT2632558	hsa-miR-3658	CLIP-seq
MIRT1388990	hsa-miR-3665	CLIP-seq
MIRT2632559	hsa-miR-3671	CLIP-seq
MIRT1388991	hsa-miR-4262	CLIP-seq
MIRT2632560	hsa-miR-4286	CLIP-seq
MIRT1557130	hsa-miR-4310	CLIP-seq
MIRT2632561	hsa-miR-4420	CLIP-seq
MIRT1557131	hsa-miR-4422	CLIP-seq
MIRT2632562	hsa-miR-4640-3p	CLIP-seq
MIRT2632563	hsa-miR-4661-5p	CLIP-seq
MIRT1388993	hsa-miR-4678	CLIP-seq
MIRT2632564	hsa-miR-4760-3p	CLIP-seq
MIRT2632565	hsa-miR-4772-3p	CLIP-seq
MIRT1388994	hsa-miR-498	CLIP-seq
MIRT2632566	hsa-miR-500a	CLIP-seq
MIRT2632567	hsa-miR-501-5p	CLIP-seq
MIRT1388996	hsa-miR-548ag	CLIP-seq
MIRT1388997	hsa-miR-548ai	CLIP-seq
MIRT1388998	hsa-miR-548m	CLIP-seq
MIRT2632568	hsa-miR-577	CLIP-seq
MIRT1388999	hsa-miR-633	CLIP-seq
MIRT1389000	hsa-miR-657	CLIP-seq
MIRT1554156	hsa-miR-892a	CLIP-seq
MIRT2632548	hsa-miR-10a	CLIP-seq
MIRT2632549	hsa-miR-10b	CLIP-seq
MIRT2632550	hsa-miR-1208	CLIP-seq
MIRT2632551	hsa-miR-1283	CLIP-seq
MIRT1388982	hsa-miR-1305	CLIP-seq
MIRT1388983	hsa-miR-181a	CLIP-seq
MIRT1388984	hsa-miR-181b	CLIP-seq
MIRT1388985	hsa-miR-181c	CLIP-seq
MIRT1388986	hsa-miR-181d	CLIP-seq
MIRT2691969	hsa-miR-194	CLIP-seq
MIRT2632552	hsa-miR-2276	CLIP-seq
MIRT1554154	hsa-miR-2277-3p	CLIP-seq
MIRT2691970	hsa-miR-3120-3p	CLIP-seq
MIRT2632553	hsa-miR-3121-3p	CLIP-seq
MIRT2691971	hsa-miR-3122	CLIP-seq
MIRT1557127	hsa-miR-3163	CLIP-seq
MIRT2691972	hsa-miR-3170	CLIP-seq
MIRT2632554	hsa-miR-3194-3p	CLIP-seq
MIRT2691973	hsa-miR-342-5p	CLIP-seq
MIRT2632555	hsa-miR-3607-3p	CLIP-seq
MIRT1388988	hsa-miR-3613-3p	CLIP-seq
MIRT2632556	hsa-miR-3620	CLIP-seq
MIRT1388990	hsa-miR-3665	CLIP-seq
MIRT2632559	hsa-miR-3671	CLIP-seq
MIRT2691974	hsa-miR-3689a-3p	CLIP-seq
MIRT2691975	hsa-miR-3689c	CLIP-seq
MIRT2691976	hsa-miR-380	CLIP-seq
MIRT2691977	hsa-miR-3913-5p	CLIP-seq
MIRT2691978	hsa-miR-3924	CLIP-seq
MIRT2691979	hsa-miR-4260	CLIP-seq
MIRT1388991	hsa-miR-4262	CLIP-seq
MIRT2632560	hsa-miR-4286	CLIP-seq
MIRT1557130	hsa-miR-4310	CLIP-seq
MIRT2632561	hsa-miR-4420	CLIP-seq
MIRT1557131	hsa-miR-4422	CLIP-seq
MIRT2691980	hsa-miR-4424	CLIP-seq
MIRT2691981	hsa-miR-4495	CLIP-seq
MIRT2632562	hsa-miR-4640-3p	CLIP-seq
MIRT2691982	hsa-miR-4651	CLIP-seq
MIRT2691983	hsa-miR-4653-3p	CLIP-seq
MIRT2632563	hsa-miR-4661-5p	CLIP-seq
MIRT2691984	hsa-miR-4664-5p	CLIP-seq
MIRT1388993	hsa-miR-4678	CLIP-seq
MIRT2691985	hsa-miR-4694-5p	CLIP-seq
MIRT2632565	hsa-miR-4772-3p	CLIP-seq
MIRT1554155	hsa-miR-4775	CLIP-seq
MIRT1388994	hsa-miR-498	CLIP-seq
MIRT2632566	hsa-miR-500a	CLIP-seq
MIRT2632567	hsa-miR-501-5p	CLIP-seq
MIRT1388996	hsa-miR-548ag	CLIP-seq
MIRT1388997	hsa-miR-548ai	CLIP-seq
MIRT1388998	hsa-miR-548m	CLIP-seq
MIRT2632568	hsa-miR-577	CLIP-seq
MIRT2691986	hsa-miR-608	CLIP-seq
MIRT2691987	hsa-miR-609	CLIP-seq
MIRT1388999	hsa-miR-633	CLIP-seq
MIRT1389000	hsa-miR-657	CLIP-seq
MIRT1554156	hsa-miR-892a	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0001818	Process	Negative regulation of cytokine production	ISS
GO:0005515	Function	Protein binding	IPI	11911826, 16189514, 21268013, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	11154222
GO:0005764	Component	Lysosome	IEA
GO:0005794	Component	Golgi apparatus	IDA	15136585
GO:0005794	Component	Golgi apparatus	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0016485	Process	Protein processing	IEA
GO:0016485	Process	Protein processing	ISS
GO:0030141	Component	Secretory granule	IBA
GO:0030502	Process	Negative regulation of bone mineralization	IBA
GO:0030502	Process	Negative regulation of bone mineralization	IDA	16870619
GO:0031012	Component	Extracellular matrix	HDA	33266304
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031214	Process	Biomineral tissue development	IEA
GO:0033363	Process	Secretory granule organization	IBA
GO:0033364	Process	Mast cell secretory granule organization	IEA
GO:0033364	Process	Mast cell secretory granule organization	ISS
GO:0033371	Process	T cell secretory granule organization	IEA
GO:0033371	Process	T cell secretory granule organization	ISS
GO:0033373	Process	Maintenance of protease location in mast cell secretory granule	IEA
GO:0033373	Process	Maintenance of protease location in mast cell secretory granule	ISS
GO:0033382	Process	Maintenance of granzyme B location in T cell secretory granule	IEA
GO:0033382	Process	Maintenance of granzyme B location in T cell secretory granule	ISS
GO:0042629	Component	Mast cell granule	IEA
GO:0042629	Component	Mast cell granule	ISS
GO:0044194	Component	Cytolytic granule	IEA
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IDA	11911826

MIM	HGNC	e!Ensembl
177040	9361	ENSG00000122862

P10124

Protein name

Serglycin (Hematopoietic proteoglycan core protein) (Platelet proteoglycan core protein) (P.PG) (Secretory granule proteoglycan core protein)

Protein function

Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04360	Serglycin	3 → 151	Serglycin	Family

Sequence

MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELL
PGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY
QLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML

Sequence length

158

Interactions

View interactions

	Reactome
			Platelet degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (54)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Stimulate	27819672, 31898491	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	35935579	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	39657893	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	24205138, 26581653, 27819672, 34924500	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Associate	26527314	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	36920176	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Stimulate	27819672	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	31898491	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Associate	30368515	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	26694746	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Associate	31455417	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	24958816, 30121667, 34676149, 34814322, 39494275	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dendritic Cell Sarcoma Follicular	Associate	28145886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Associate	21804080	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Associate	26694746	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	33314317	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Associate	33314317	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	36632458	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	36632458, 37561524	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	28445977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	28445977, 37248887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	30368515	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Associate	31562900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	40449756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	26694746	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	30121667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Associate	31562900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	26694746	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Associate	29698332	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Associate	37965330	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Erythroblastic Acute	Associate	14506241	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	29286103, 35569433	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Associate	1377686, 14506241	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Stimulate	27819672	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Associate	31562900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Stimulate	32370744	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Associate	34753832	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Associate	29523930	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Stimulate	16870619	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	23387827	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	35562411	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	24205138, 30121667, 36632458	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24205138, 26581653, 26694746, 28145886, 31898491, 32370744, 33110154, 34753832, 34924500, 36632458	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	27819672, 28445977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	34493692	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	37090158	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pigmentary Disorder Reticulate with Systemic Manifestations	Stimulate	33314317	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post Acute COVID 19 Syndrome	Associate	37924708	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Associate	26507871	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	33070392	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	34910689	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	38425243	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	37391754	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	26694746	★★★★★ ★☆☆☆☆ Found in Text Mining only

SRGN (serglycin)