Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5551
Gene name Gene Name - the full gene name approved by the HGNC.
Perforin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRF1
Synonyms (NCBI Gene) Gene synonyms aliases
HPLH2, P1, PFP
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with structural similarities to complement component C9 that is important in immunity. This protein forms membrane pores that allow the release of granzymes and subsequent cytolysis of target cells. Whether pore formation occur
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28933374 G>A,T Pathogenic Missense variant, coding sequence variant
rs28933375 T>C Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Missense variant, coding sequence variant
rs28933376 G>A Pathogenic Missense variant, coding sequence variant
rs28933973 G>A Pathogenic Missense variant, coding sequence variant
rs35418374 C>T Pathogenic, benign, likely-benign Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT755480 hsa-miR-221-5p Luciferase reporter assay, Western blotting, qRT-PCR 36499501
MIRT1261237 hsa-miR-124 CLIP-seq
MIRT1261238 hsa-miR-145 CLIP-seq
MIRT1261239 hsa-miR-219-2-3p CLIP-seq
MIRT1261240 hsa-miR-2682 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
STAT4 Activation 12372421
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001771 Process Immunological synapse formation IBA
GO:0001771 Process Immunological synapse formation IDA 21438968
GO:0001772 Component Immunological synapse IEA
GO:0001772 Component Immunological synapse ISS
GO:0001778 Process Plasma membrane repair IDA 20530211
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
170280 9360 ENSG00000180644
Protein
UniProt ID P14222
Protein name Perforin-1 (P1) (Cytolysin) (Lymphocyte pore-forming protein) (PFP)
Protein function Pore-forming protein that plays a key role in granzyme-mediated programmed cell death, and in defense against virus-infected or neoplastic cells (PubMed:20889983, PubMed:21037563, PubMed:24558045, PubMed:9058810, PubMed:9164947). Plays an import
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01823 MACPF 147 367 MAC/Perforin domain Domain
PF00168 C2 415 508 C2 domain Domain
Sequence
MAARLLLLGILLLLLPLPVPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD
AARSIRNDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYS
FHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALR
TCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERH
SEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREAL
RRALSQY
LTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT
FIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRL
QVWDQDSGRDDDLLGTCDQAPKSGSHEV
RCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQ
MLLGEPPGNRSGAVW
Sequence length 555
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Aplastic anemia aplastic anemia rs189650890, rs28933376, rs776299562, rs751247865, rs752858869, rs28933973, rs771552960, rs776571416, rs147462227, rs578092914, rs786205093, rs104894182, rs104894176, rs200430442, rs193302876
View all (4 more)
N/A
Autoinflammatory Disease Autoinflammatory syndrome rs28933973, rs104894176, rs147035858, rs28933376 N/A
Hemophagocytic Lymphohistiocytosis familial hemophagocytic lymphohistiocytosis, Familial hemophagocytic lymphohistiocytosis 2, Familial hemophagocytic lymphohistiocytosis type 1 rs28933973, rs1564724291, rs752858869, rs771552960, rs1848204643, rs751247865, rs776571416, rs1060499556, rs147462227, rs578092914, rs104894181, rs201032696, rs786205093, rs104894176, rs104894182
View all (13 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Lymphoma lymphoma, non-hodgkin, familial, lymphoma, non-Hodgkin, familial N/A N/A ClinVar, GenCC
Neurodegenerative Disorders fatal post-viral neurodegenerative disorder N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35733175
Alcoholism Stimulate 21121937
Anemia Aplastic Associate 17311987
Arthritis Rheumatoid Associate 29388193
Asthma Associate 37730635
Ataxia Associate 23443029, 37390248
Ataxia Telangiectasia Associate 30009527
Autoimmune Diseases Associate 33566725, 38149249
Autoimmune Lymphoproliferative Syndrome Associate 15459303, 18198357
Bone Marrow Failure Disorders Associate 17311987