Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55505
Gene name	NOP10 ribonucleoprotein
Gene symbol	NOP10
Synonyms (NCBI Gene)	CHINE2DKCB1NOLA3NOP10PPFBMFT9
Chromosome	15
Chromosome location	15q14
Summary	This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl

107

Show/Hide all (107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029941	hsa-miR-26b-5p	Microarray	19088304
MIRT031870	hsa-miR-16-5p	Proteomics	18668040
MIRT038200	hsa-miR-151a-5p	CLASH	23622248
MIRT1189297	hsa-miR-105	CLIP-seq
MIRT1189298	hsa-miR-194	CLIP-seq
MIRT1189299	hsa-miR-377	CLIP-seq
MIRT1189300	hsa-miR-409-5p	CLIP-seq
MIRT1189301	hsa-miR-4294	CLIP-seq
MIRT1189302	hsa-miR-4517	CLIP-seq
MIRT1189303	hsa-miR-4712-3p	CLIP-seq
MIRT1189304	hsa-miR-4731-3p	CLIP-seq
MIRT1189305	hsa-miR-4788	CLIP-seq
MIRT1189306	hsa-miR-4801	CLIP-seq
MIRT1189307	hsa-miR-539	CLIP-seq
MIRT1189308	hsa-miR-552	CLIP-seq
MIRT1189309	hsa-miR-659	CLIP-seq
MIRT1556739	hsa-miR-1243	CLIP-seq
MIRT1556740	hsa-miR-4463	CLIP-seq
MIRT1556739	hsa-miR-1243	CLIP-seq
MIRT2054826	hsa-miR-1262	CLIP-seq
MIRT2054827	hsa-miR-3115	CLIP-seq
MIRT1189300	hsa-miR-409-5p	CLIP-seq
MIRT1556740	hsa-miR-4463	CLIP-seq
MIRT2054828	hsa-miR-4671-5p	CLIP-seq
MIRT2054829	hsa-miR-4701-3p	CLIP-seq
MIRT2054830	hsa-miR-4715-3p	CLIP-seq
MIRT1189305	hsa-miR-4788	CLIP-seq
MIRT1189309	hsa-miR-659	CLIP-seq
MIRT1556739	hsa-miR-1243	CLIP-seq
MIRT2283856	hsa-miR-342-3p	CLIP-seq
MIRT1189299	hsa-miR-377	CLIP-seq
MIRT1189300	hsa-miR-409-5p	CLIP-seq
MIRT1189301	hsa-miR-4294	CLIP-seq
MIRT1556740	hsa-miR-4463	CLIP-seq
MIRT1189304	hsa-miR-4731-3p	CLIP-seq
MIRT1189305	hsa-miR-4788	CLIP-seq
MIRT1189306	hsa-miR-4801	CLIP-seq
MIRT1556739	hsa-miR-1243	CLIP-seq
MIRT2582026	hsa-miR-128	CLIP-seq
MIRT2582027	hsa-miR-135a	CLIP-seq
MIRT2582028	hsa-miR-135b	CLIP-seq
MIRT1189298	hsa-miR-194	CLIP-seq
MIRT2582029	hsa-miR-27a	CLIP-seq
MIRT2582030	hsa-miR-27b	CLIP-seq
MIRT2582031	hsa-miR-3127-5p	CLIP-seq
MIRT2582032	hsa-miR-3128	CLIP-seq
MIRT2582033	hsa-miR-3617	CLIP-seq
MIRT2582034	hsa-miR-3652	CLIP-seq
MIRT1189299	hsa-miR-377	CLIP-seq
MIRT2582035	hsa-miR-3910	CLIP-seq
MIRT2582036	hsa-miR-3913-3p	CLIP-seq
MIRT2582037	hsa-miR-3918	CLIP-seq
MIRT1189300	hsa-miR-409-5p	CLIP-seq
MIRT2582038	hsa-miR-4284	CLIP-seq
MIRT1189301	hsa-miR-4294	CLIP-seq
MIRT2582039	hsa-miR-4328	CLIP-seq
MIRT2582040	hsa-miR-4430	CLIP-seq
MIRT2582041	hsa-miR-4437	CLIP-seq
MIRT1556740	hsa-miR-4463	CLIP-seq
MIRT2582042	hsa-miR-4470	CLIP-seq
MIRT2582043	hsa-miR-4475	CLIP-seq
MIRT2582044	hsa-miR-4477b	CLIP-seq
MIRT2582045	hsa-miR-4505	CLIP-seq
MIRT2054828	hsa-miR-4671-5p	CLIP-seq
MIRT2582046	hsa-miR-4711-5p	CLIP-seq
MIRT1189304	hsa-miR-4731-3p	CLIP-seq
MIRT1189305	hsa-miR-4788	CLIP-seq
MIRT1189306	hsa-miR-4801	CLIP-seq
MIRT2582047	hsa-miR-548an	CLIP-seq
MIRT1189308	hsa-miR-552	CLIP-seq
MIRT2582048	hsa-miR-641	CLIP-seq
MIRT1189309	hsa-miR-659	CLIP-seq
MIRT1556739	hsa-miR-1243	CLIP-seq
MIRT2582026	hsa-miR-128	CLIP-seq
MIRT2582027	hsa-miR-135a	CLIP-seq
MIRT2582028	hsa-miR-135b	CLIP-seq
MIRT1189298	hsa-miR-194	CLIP-seq
MIRT2582029	hsa-miR-27a	CLIP-seq
MIRT2582030	hsa-miR-27b	CLIP-seq
MIRT2582031	hsa-miR-3127-5p	CLIP-seq
MIRT2582032	hsa-miR-3128	CLIP-seq
MIRT2582033	hsa-miR-3617	CLIP-seq
MIRT2582034	hsa-miR-3652	CLIP-seq
MIRT1189299	hsa-miR-377	CLIP-seq
MIRT2582035	hsa-miR-3910	CLIP-seq
MIRT2582036	hsa-miR-3913-3p	CLIP-seq
MIRT2582037	hsa-miR-3918	CLIP-seq
MIRT1189300	hsa-miR-409-5p	CLIP-seq
MIRT2582038	hsa-miR-4284	CLIP-seq
MIRT1189301	hsa-miR-4294	CLIP-seq
MIRT2582039	hsa-miR-4328	CLIP-seq
MIRT2582040	hsa-miR-4430	CLIP-seq
MIRT2582041	hsa-miR-4437	CLIP-seq
MIRT1556740	hsa-miR-4463	CLIP-seq
MIRT2582042	hsa-miR-4470	CLIP-seq
MIRT2582043	hsa-miR-4475	CLIP-seq
MIRT2582044	hsa-miR-4477b	CLIP-seq
MIRT2582045	hsa-miR-4505	CLIP-seq
MIRT2054828	hsa-miR-4671-5p	CLIP-seq
MIRT2582046	hsa-miR-4711-5p	CLIP-seq
MIRT1189304	hsa-miR-4731-3p	CLIP-seq
MIRT1189305	hsa-miR-4788	CLIP-seq
MIRT1189306	hsa-miR-4801	CLIP-seq
MIRT2582047	hsa-miR-548an	CLIP-seq
MIRT1189308	hsa-miR-552	CLIP-seq
MIRT2582048	hsa-miR-641	CLIP-seq
MIRT1189309	hsa-miR-659	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001522	Process	Pseudouridine synthesis	IEA
GO:0001522	Process	Pseudouridine synthesis	NAS	9843512
GO:0003723	Function	RNA binding	IPI	18082603
GO:0005515	Function	Protein binding	IPI	16601202, 23685356, 25416956, 25910212, 30021884, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005697	Component	Telomerase holoenzyme complex	IDA	18082603, 29695869
GO:0005697	Component	Telomerase holoenzyme complex	NAS	20351177
GO:0005697	Component	Telomerase holoenzyme complex	TAS	20351177, 22527283
GO:0005730	Component	Nucleolus	IEA
GO:0005732	Component	Sno(s)RNA-containing ribonucleoprotein complex	TAS	9843512
GO:0006364	Process	RRNA processing	IEA
GO:0007004	Process	Telomere maintenance via telomerase	IDA	29695869
GO:0007004	Process	Telomere maintenance via telomerase	NAS	20351177
GO:0007004	Process	Telomere maintenance via telomerase	TAS	22527283
GO:0015030	Component	Cajal body	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030515	Function	SnoRNA binding	IEA
GO:0031118	Process	RRNA pseudouridine synthesis	IBA
GO:0031120	Process	SnRNA pseudouridine synthesis	IBA
GO:0031429	Component	Box H/ACA snoRNP complex	IBA
GO:0031429	Component	Box H/ACA snoRNP complex	IDA	18082603
GO:0031429	Component	Box H/ACA snoRNP complex	TAS	22527283
GO:0034513	Function	Box H/ACA snoRNA binding	IPI	18082603
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0070034	Function	Telomerase RNA binding	IBA
GO:0070034	Function	Telomerase RNA binding	IPI	18082603
GO:0070034	Function	Telomerase RNA binding	TAS	22527283
GO:0072589	Component	Box H/ACA scaRNP complex	TAS	22527283
GO:0090661	Component	Box H/ACA telomerase RNP complex	IDA	18082603
GO:0090661	Component	Box H/ACA telomerase RNP complex	TAS	22527283
GO:0090671	Process	Telomerase RNA localization to Cajal body	HMP	25467444
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
606471	14378	ENSG00000182117

Q9NPE3

Protein name

H/ACA ribonucleoprotein complex subunit 3 (Nucleolar protein 10) (Nucleolar protein family A member 3) (snoRNP protein NOP10)

Protein function

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA (PubMed:32554502). This involves the isomerization of uridine such t

PDB

7BGB , 7TRC , 7V9A , 8OUE , 8OUF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04135	Nop10p	3 → 52	Nucleolar RNA-binding protein, Nop10p family	Family

Sequence

MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP
RPVL

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Ribosome biogenesis in eukaryotes		Telomere Extension By Telomerase rRNA modification in the nucleus and cytosol

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cataracts, hearing impairment, nephrotic syndrome, and enterocolitis 2	Pathogenic	rs1321378060	RCV003236697

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Likely benign	rs200017156	RCV005896807
Cervical cancer	Benign; Likely benign	rs200017156	RCV005896808
Dyskeratosis congenita	Likely benign; Benign; Uncertain significance	rs746979721, rs422388, rs1890487224	RCV005385099 RCV002347962 RCV004488049
Dyskeratosis congenita, autosomal recessive 1	Uncertain significance; Likely benign; not provided; Conflicting classifications of pathogenicity; Benign	rs748193565, rs1890485477, rs1890485969, rs2141228644, rs373843596, rs370894572, rs562412129, rs746979721, rs752083783, rs2141230426, rs1890511080, rs368082745, rs1042150335, rs2510094741, rs121908092 View all (37 more)	RCV001317644 RCV001340074 RCV001352516 RCV001362716 RCV001368203 RCV001362680 RCV001430931 RCV001448685 RCV001967923 RCV001998622 RCV002024627 RCV001936139 RCV003067407 RCV002659714 RCV000004500 RCV002659048 RCV002663720 RCV002745315 RCV002722072 RCV002711704 RCV002900273 RCV002909629 RCV003032816 RCV001084193 RCV000398067 RCV003503940 RCV003504191 RCV003504246 RCV003611849 RCV003612544 RCV003612327 RCV003612336 RCV000398103 RCV000374342 RCV000306780 RCV000331228 RCV000285526 RCV000310239 RCV000538557 RCV000276206 RCV000263141 RCV001116064 RCV000526147 RCV000541648 RCV000806271 RCV000798486 RCV000865303 RCV001435432 RCV001062894 RCV001119013 RCV001120987 RCV001120989 RCV001120990 RCV001117506 RCV001117507
Dyskeratosis Congenita, Recessive	Conflicting classifications of pathogenicity; Uncertain significance; Benign; Likely benign	rs528879821, rs554420284, rs2169480	RCV000340370 RCV000367184 RCV000352550
Familial cancer of breast	Benign; Likely benign	rs141981162, rs200017156	RCV005899881 RCV005896806
Gastric cancer	Benign; Likely benign	rs200017156	RCV005896809
Hereditary cancer-predisposing syndrome	Conflicting classifications of pathogenicity; Benign; Likely benign	rs72720799, rs200017156, rs756047969	RCV002256204 RCV002257809 RCV002256564
Malignant lymphoma, large B-cell, diffuse	Benign	rs1045238	RCV005893356
Nonpapillary renal cell carcinoma	Benign	rs1045238	RCV005893354
Pulmonary fibrosis and/or bone marrow failure syndrome, telomere-related, 9	Uncertain significance; Conflicting classifications of pathogenicity; no classifications from unflagged records	rs370894572, rs368082745, rs146261631, rs2510095937	RCV005005882 RCV005006250 RCV005409634 RCV003232878
Uterine carcinosarcoma	Benign; Likely benign	rs1045238, rs200017156	RCV005893357 RCV005896810
Uterine corpus endometrial carcinoma	Benign; Likely benign	rs200017156	RCV005896811
Uveal melanoma	Benign	rs1045238	RCV005893355

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Non Small Cell Lung	Associate	33288886
Dyskeratosis Congenita	Associate	16427014, 17507419, 19036115, 29055871, 30728146
Dyskeratosis Congenita Autosomal Recessive	Associate	17507419
Endometrial Neoplasms	Associate	35054812
Leukemia Lymphocytic Chronic B Cell	Associate	28666010
Lung Neoplasms	Associate	33288886
Melanoma	Associate	35085295
Polycystic Ovary Syndrome	Stimulate	38243290
Stroke	Associate	37358014
Telomeric 22q13 Monosomy Syndrome	Associate	37440454

NOP10 (NOP10 ribonucleoprotein)