Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55505
Gene name Gene Name - the full gene name approved by the HGNC.	NOP10 ribonucleoprotein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NOP10
Synonyms (NCBI Gene) Gene synonyms aliases	CHINE2, DKCB1, NOLA3, NOP10P, PFBMFT9
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q14
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl

Show/Hide all(107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029941	hsa-miR-26b-5p	Microarray	19088304
MIRT031870	hsa-miR-16-5p	Proteomics	18668040
MIRT038200	hsa-miR-151a-5p	CLASH	23622248
MIRT1189297	hsa-miR-105	CLIP-seq
MIRT1189298	hsa-miR-194	CLIP-seq
MIRT1189299	hsa-miR-377	CLIP-seq
MIRT1189300	hsa-miR-409-5p	CLIP-seq
MIRT1189301	hsa-miR-4294	CLIP-seq
MIRT1189302	hsa-miR-4517	CLIP-seq
MIRT1189303	hsa-miR-4712-3p	CLIP-seq
MIRT1189304	hsa-miR-4731-3p	CLIP-seq
MIRT1189305	hsa-miR-4788	CLIP-seq
MIRT1189306	hsa-miR-4801	CLIP-seq
MIRT1189307	hsa-miR-539	CLIP-seq
MIRT1189308	hsa-miR-552	CLIP-seq
MIRT1189309	hsa-miR-659	CLIP-seq
MIRT1556739	hsa-miR-1243	CLIP-seq
MIRT1556740	hsa-miR-4463	CLIP-seq
MIRT1556739	hsa-miR-1243	CLIP-seq
MIRT2054826	hsa-miR-1262	CLIP-seq
MIRT2054827	hsa-miR-3115	CLIP-seq
MIRT1189300	hsa-miR-409-5p	CLIP-seq
MIRT1556740	hsa-miR-4463	CLIP-seq
MIRT2054828	hsa-miR-4671-5p	CLIP-seq
MIRT2054829	hsa-miR-4701-3p	CLIP-seq
MIRT2054830	hsa-miR-4715-3p	CLIP-seq
MIRT1189305	hsa-miR-4788	CLIP-seq
MIRT1189309	hsa-miR-659	CLIP-seq
MIRT1556739	hsa-miR-1243	CLIP-seq
MIRT2283856	hsa-miR-342-3p	CLIP-seq
MIRT1189299	hsa-miR-377	CLIP-seq
MIRT1189300	hsa-miR-409-5p	CLIP-seq
MIRT1189301	hsa-miR-4294	CLIP-seq
MIRT1556740	hsa-miR-4463	CLIP-seq
MIRT1189304	hsa-miR-4731-3p	CLIP-seq
MIRT1189305	hsa-miR-4788	CLIP-seq
MIRT1189306	hsa-miR-4801	CLIP-seq
MIRT1556739	hsa-miR-1243	CLIP-seq
MIRT2582026	hsa-miR-128	CLIP-seq
MIRT2582027	hsa-miR-135a	CLIP-seq
MIRT2582028	hsa-miR-135b	CLIP-seq
MIRT1189298	hsa-miR-194	CLIP-seq
MIRT2582029	hsa-miR-27a	CLIP-seq
MIRT2582030	hsa-miR-27b	CLIP-seq
MIRT2582031	hsa-miR-3127-5p	CLIP-seq
MIRT2582032	hsa-miR-3128	CLIP-seq
MIRT2582033	hsa-miR-3617	CLIP-seq
MIRT2582034	hsa-miR-3652	CLIP-seq
MIRT1189299	hsa-miR-377	CLIP-seq
MIRT2582035	hsa-miR-3910	CLIP-seq
MIRT2582036	hsa-miR-3913-3p	CLIP-seq
MIRT2582037	hsa-miR-3918	CLIP-seq
MIRT1189300	hsa-miR-409-5p	CLIP-seq
MIRT2582038	hsa-miR-4284	CLIP-seq
MIRT1189301	hsa-miR-4294	CLIP-seq
MIRT2582039	hsa-miR-4328	CLIP-seq
MIRT2582040	hsa-miR-4430	CLIP-seq
MIRT2582041	hsa-miR-4437	CLIP-seq
MIRT1556740	hsa-miR-4463	CLIP-seq
MIRT2582042	hsa-miR-4470	CLIP-seq
MIRT2582043	hsa-miR-4475	CLIP-seq
MIRT2582044	hsa-miR-4477b	CLIP-seq
MIRT2582045	hsa-miR-4505	CLIP-seq
MIRT2054828	hsa-miR-4671-5p	CLIP-seq
MIRT2582046	hsa-miR-4711-5p	CLIP-seq
MIRT1189304	hsa-miR-4731-3p	CLIP-seq
MIRT1189305	hsa-miR-4788	CLIP-seq
MIRT1189306	hsa-miR-4801	CLIP-seq
MIRT2582047	hsa-miR-548an	CLIP-seq
MIRT1189308	hsa-miR-552	CLIP-seq
MIRT2582048	hsa-miR-641	CLIP-seq
MIRT1189309	hsa-miR-659	CLIP-seq
MIRT1556739	hsa-miR-1243	CLIP-seq
MIRT2582026	hsa-miR-128	CLIP-seq
MIRT2582027	hsa-miR-135a	CLIP-seq
MIRT2582028	hsa-miR-135b	CLIP-seq
MIRT1189298	hsa-miR-194	CLIP-seq
MIRT2582029	hsa-miR-27a	CLIP-seq
MIRT2582030	hsa-miR-27b	CLIP-seq
MIRT2582031	hsa-miR-3127-5p	CLIP-seq
MIRT2582032	hsa-miR-3128	CLIP-seq
MIRT2582033	hsa-miR-3617	CLIP-seq
MIRT2582034	hsa-miR-3652	CLIP-seq
MIRT1189299	hsa-miR-377	CLIP-seq
MIRT2582035	hsa-miR-3910	CLIP-seq
MIRT2582036	hsa-miR-3913-3p	CLIP-seq
MIRT2582037	hsa-miR-3918	CLIP-seq
MIRT1189300	hsa-miR-409-5p	CLIP-seq
MIRT2582038	hsa-miR-4284	CLIP-seq
MIRT1189301	hsa-miR-4294	CLIP-seq
MIRT2582039	hsa-miR-4328	CLIP-seq
MIRT2582040	hsa-miR-4430	CLIP-seq
MIRT2582041	hsa-miR-4437	CLIP-seq
MIRT1556740	hsa-miR-4463	CLIP-seq
MIRT2582042	hsa-miR-4470	CLIP-seq
MIRT2582043	hsa-miR-4475	CLIP-seq
MIRT2582044	hsa-miR-4477b	CLIP-seq
MIRT2582045	hsa-miR-4505	CLIP-seq
MIRT2054828	hsa-miR-4671-5p	CLIP-seq
MIRT2582046	hsa-miR-4711-5p	CLIP-seq
MIRT1189304	hsa-miR-4731-3p	CLIP-seq
MIRT1189305	hsa-miR-4788	CLIP-seq
MIRT1189306	hsa-miR-4801	CLIP-seq
MIRT2582047	hsa-miR-548an	CLIP-seq
MIRT1189308	hsa-miR-552	CLIP-seq
MIRT2582048	hsa-miR-641	CLIP-seq
MIRT1189309	hsa-miR-659	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001522	Process	Pseudouridine synthesis	IEA
GO:0001522	Process	Pseudouridine synthesis	NAS	9843512
GO:0003723	Function	RNA binding	IPI	18082603
GO:0005515	Function	Protein binding	IPI	16601202, 23685356, 25416956, 25910212, 30021884, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005697	Component	Telomerase holoenzyme complex	IDA	18082603, 29695869
GO:0005697	Component	Telomerase holoenzyme complex	NAS	20351177
GO:0005697	Component	Telomerase holoenzyme complex	TAS	20351177, 22527283
GO:0005730	Component	Nucleolus	IEA
GO:0005732	Component	Sno(s)RNA-containing ribonucleoprotein complex	TAS	9843512
GO:0006364	Process	RRNA processing	IEA
GO:0007004	Process	Telomere maintenance via telomerase	IDA	29695869
GO:0007004	Process	Telomere maintenance via telomerase	NAS	20351177
GO:0007004	Process	Telomere maintenance via telomerase	TAS	22527283
GO:0015030	Component	Cajal body	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030515	Function	SnoRNA binding	IEA
GO:0031118	Process	RRNA pseudouridine synthesis	IBA
GO:0031120	Process	SnRNA pseudouridine synthesis	IBA
GO:0031429	Component	Box H/ACA snoRNP complex	IBA
GO:0031429	Component	Box H/ACA snoRNP complex	IDA	18082603
GO:0031429	Component	Box H/ACA snoRNP complex	TAS	22527283
GO:0034513	Function	Box H/ACA snoRNA binding	IPI	18082603
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0070034	Function	Telomerase RNA binding	IBA
GO:0070034	Function	Telomerase RNA binding	IPI	18082603
GO:0070034	Function	Telomerase RNA binding	TAS	22527283
GO:0072589	Component	Box H/ACA scaRNP complex	TAS	22527283
GO:0090661	Component	Box H/ACA telomerase RNP complex	IDA	18082603
GO:0090661	Component	Box H/ACA telomerase RNP complex	TAS	22527283
GO:0090671	Process	Telomerase RNA localization to Cajal body	HMP	25467444
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
606471	14378	ENSG00000182117

Protein

UniProt ID

Q9NPE3

Protein name

H/ACA ribonucleoprotein complex subunit 3 (Nucleolar protein 10) (Nucleolar protein family A member 3) (snoRNP protein NOP10)

Protein function

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA (PubMed:32554502). This involves the isomerization of uridine such t

PDB

7BGB , 7TRC , 7V9A , 8OUE , 8OUF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04135	Nop10p	3 → 52	Nucleolar RNA-binding protein, Nop10p family	Family

Sequence

MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP
RPVL

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Ribosome biogenesis in eukaryotes		Telomere Extension By Telomerase rRNA modification in the nucleus and cytosol

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Dyskeratosis Congenita	dyskeratosis congenita, autosomal recessive 1	rs121908092	N/A

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Pulmonary Fibrosis	pulmonary fibrosis and/or bone marrow failure syndrome, telomere-related, 9	N/A	N/A	GenCC

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Non Small Cell Lung	Associate	33288886
Dyskeratosis Congenita	Associate	16427014, 17507419, 19036115, 29055871, 30728146
Dyskeratosis Congenita Autosomal Recessive	Associate	17507419
Endometrial Neoplasms	Associate	35054812
Leukemia Lymphocytic Chronic B Cell	Associate	28666010
Lung Neoplasms	Associate	33288886
Melanoma	Associate	35085295
Polycystic Ovary Syndrome	Stimulate	38243290
Stroke	Associate	37358014
Telomeric 22q13 Monosomy Syndrome	Associate	37440454

NOP10 (NOP10 ribonucleoprotein)