Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55504
Gene name Gene Name - the full gene name approved by the HGNC.
TNF receptor superfamily member 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFRSF19
Synonyms (NCBI Gene) Gene synonyms aliases
TAJ, TAJ-alpha, TRADE, TROY
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q12.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1442980 hsa-miR-1206 CLIP-seq
MIRT1442981 hsa-miR-3656 CLIP-seq
MIRT1442982 hsa-miR-433 CLIP-seq
MIRT1442983 hsa-miR-4786-5p CLIP-seq
MIRT1442984 hsa-miR-609 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001942 Process Hair follicle development IEA
GO:0005031 Function Tumor necrosis factor receptor activity NAS 10809768
GO:0005515 Function Protein binding IPI 30337686, 32296183
GO:0005886 Component Plasma membrane IBA
GO:0006915 Process Apoptotic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606122 11915 ENSG00000127863
Protein
UniProt ID Q9NS68
Protein name Tumor necrosis factor receptor superfamily member 19 (TRADE) (Toxicity and JNK inducer)
Protein function Can mediate activation of JNK and NF-kappa-B. May promote caspase-independent cell death.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 34 72 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 75 114 TNFR/NGFR cysteine-rich region Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in prostate. Detected at lower levels in thymus, spleen, testis, uterus, small intestine, colon and peripheral blood leukocytes.
Sequence
MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSK
ECGFGYGEDAQC
VTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPG
FYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALAT
VLLALLILCVIYCKRQFMEKKPSWSLRSQDIQYNGSELSCFDRPQLHEYAHRACCQCRRD
SVQTCGPVRLLPSMCCEEACSPNPATLGCGVHSAASLQARNAGPAGEMVPTFFGSLTQSI
CGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSNSSQDLVGGAV
PVQSHSENFTAATDLSRYNNTLVESASTQDALTMRSQLDQESGAVIHPATQTSLQVRQRL
GSL
Sequence length 423
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Cytokine-cytokine receptor interaction  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Nasopharyngeal Carcinoma Nasopharyngeal carcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34301211
Alzheimer Disease Stimulate 39596356
Bohring syndrome Stimulate 15020679
Carcinoma Hepatocellular Associate 35610614
Colorectal Neoplasms Associate 33898197, 34541005, 35941638
Death Stimulate 15020679
Glioblastoma Associate 26559543
Glioblastoma Stimulate 29117939, 32629176
Glioma Associate 26559543
Glioma Stimulate 32629176