Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	55502
Gene name	Hes family bHLH transcription factor 6
Gene symbol	HES6
Synonyms (NCBI Gene)	C-HAIRY1HES-6bHLHb41bHLHc23
Chromosome	2
Chromosome location	2q37.3
Summary	This gene encodes a member of a subfamily of basic helix-loop-helix transcription repressors that have homology to the Drosophila enhancer of split genes. Members of this gene family regulate cell differentiation in numerous cell types. The protein encode

Show/Hide all (99)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024636	hsa-miR-215-5p	Microarray	19074876
MIRT026430	hsa-miR-192-5p	Microarray	19074876
MIRT044433	hsa-miR-320a	CLASH	23622248
MIRT573685	hsa-miR-6888-5p	PAR-CLIP	20371350
MIRT573684	hsa-miR-4779	PAR-CLIP	20371350
MIRT573683	hsa-miR-1321	PAR-CLIP	20371350
MIRT573681	hsa-miR-4739	PAR-CLIP	20371350
MIRT573682	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT573680	hsa-miR-7113-5p	PAR-CLIP	20371350
MIRT573679	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT573678	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT573677	hsa-miR-331-3p	PAR-CLIP	20371350
MIRT573676	hsa-miR-4292	PAR-CLIP	20371350
MIRT573674	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT573675	hsa-miR-3192-5p	PAR-CLIP	20371350
MIRT573673	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT573672	hsa-miR-4784	PAR-CLIP	20371350
MIRT573671	hsa-miR-4419a	PAR-CLIP	20371350
MIRT573670	hsa-miR-4510	PAR-CLIP	20371350
MIRT573669	hsa-miR-6127	PAR-CLIP	20371350
MIRT573668	hsa-miR-6129	PAR-CLIP	20371350
MIRT573667	hsa-miR-6130	PAR-CLIP	20371350
MIRT573666	hsa-miR-6133	PAR-CLIP	20371350
MIRT573665	hsa-miR-4683	PAR-CLIP	20371350
MIRT573664	hsa-miR-765	PAR-CLIP	20371350
MIRT573663	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT573662	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT573661	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT573660	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT573659	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT573658	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT573657	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT573655	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT573656	hsa-miR-1273h-5p	PAR-CLIP	20371350
MIRT573654	hsa-miR-30b-3p	PAR-CLIP	20371350
MIRT573653	hsa-miR-3689a-3p	PAR-CLIP	20371350
MIRT573652	hsa-miR-3689b-3p	PAR-CLIP	20371350
MIRT573651	hsa-miR-3689c	PAR-CLIP	20371350
MIRT573650	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT573649	hsa-miR-6780a-5p	PAR-CLIP	20371350
MIRT573685	hsa-miR-6888-5p	PAR-CLIP	20371350
MIRT573684	hsa-miR-4779	PAR-CLIP	20371350
MIRT573683	hsa-miR-1321	PAR-CLIP	20371350
MIRT573681	hsa-miR-4739	PAR-CLIP	20371350
MIRT573682	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT573680	hsa-miR-7113-5p	PAR-CLIP	20371350
MIRT573679	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT573678	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT573677	hsa-miR-331-3p	PAR-CLIP	20371350
MIRT573676	hsa-miR-4292	PAR-CLIP	20371350
MIRT573674	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT573675	hsa-miR-3192-5p	PAR-CLIP	20371350
MIRT573673	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT573672	hsa-miR-4784	PAR-CLIP	20371350
MIRT573671	hsa-miR-4419a	PAR-CLIP	20371350
MIRT573670	hsa-miR-4510	PAR-CLIP	20371350
MIRT573669	hsa-miR-6127	PAR-CLIP	20371350
MIRT573668	hsa-miR-6129	PAR-CLIP	20371350
MIRT573667	hsa-miR-6130	PAR-CLIP	20371350
MIRT573666	hsa-miR-6133	PAR-CLIP	20371350
MIRT573665	hsa-miR-4683	PAR-CLIP	20371350
MIRT573664	hsa-miR-765	PAR-CLIP	20371350
MIRT573663	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT573662	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT573661	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT573660	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT573659	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT573658	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT573657	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT573655	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT573656	hsa-miR-1273h-5p	PAR-CLIP	20371350
MIRT573654	hsa-miR-30b-3p	PAR-CLIP	20371350
MIRT573653	hsa-miR-3689a-3p	PAR-CLIP	20371350
MIRT573652	hsa-miR-3689b-3p	PAR-CLIP	20371350
MIRT573651	hsa-miR-3689c	PAR-CLIP	20371350
MIRT573650	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT573649	hsa-miR-6780a-5p	PAR-CLIP	20371350
MIRT1044666	hsa-miR-146b-3p	CLIP-seq
MIRT1044667	hsa-miR-2276	CLIP-seq
MIRT1044668	hsa-miR-3173-5p	CLIP-seq
MIRT1044669	hsa-miR-4257	CLIP-seq
MIRT1044670	hsa-miR-874	CLIP-seq
MIRT1044669	hsa-miR-4257	CLIP-seq
MIRT1044671	hsa-miR-7	CLIP-seq
MIRT2009739	hsa-miR-378g	CLIP-seq
MIRT2242072	hsa-miR-1285	CLIP-seq
MIRT2242073	hsa-miR-148a	CLIP-seq
MIRT2242074	hsa-miR-148b	CLIP-seq
MIRT2242075	hsa-miR-152	CLIP-seq
MIRT2242076	hsa-miR-3187-5p	CLIP-seq
MIRT2242077	hsa-miR-326	CLIP-seq
MIRT2242078	hsa-miR-330-5p	CLIP-seq
MIRT2242079	hsa-miR-34a	CLIP-seq
MIRT2242080	hsa-miR-34c-5p	CLIP-seq
MIRT2009739	hsa-miR-378g	CLIP-seq
MIRT2242081	hsa-miR-4486	CLIP-seq
MIRT2242082	hsa-miR-449a	CLIP-seq
MIRT2242083	hsa-miR-449b	CLIP-seq
MIRT2242084	hsa-miR-612	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ATOH1	Activation	17826772

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	20211142, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	ISS	10851137
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	10851137
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050767	Process	Regulation of neurogenesis	IBA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
610331	18254	ENSG00000144485

Q96HZ4

Protein name

Transcription cofactor HES-6 (C-HAIRY1) (Class B basic helix-loop-helix protein 41) (bHLHb41) (Hairy and enhancer of split 6)

Protein function

Does not bind DNA itself but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. Also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCF3/E47, allowin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	26 → 77	Helix-loop-helix DNA-binding domain	Domain
PF07527	Hairy_orange	95 → 134	Hairy Orange	Domain

Sequence

MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK
LENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDAT
VAAELLNHLLESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDD
LCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRPW

Sequence length

224

Interactions

View interactions

	KEGG
	Human papillomavirus infection

HES6 (hes family bHLH transcription factor 6)