Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55502
Gene name Gene Name - the full gene name approved by the HGNC.	Hes family bHLH transcription factor 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HES6
Synonyms (NCBI Gene) Gene synonyms aliases	C-HAIRY1, HES-6, bHLHb41, bHLHc23
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a subfamily of basic helix-loop-helix transcription repressors that have homology to the Drosophila enhancer of split genes. Members of this gene family regulate cell differentiation in numerous cell types. The protein encode

Show/Hide all(99)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024636	hsa-miR-215-5p	Microarray	19074876
MIRT026430	hsa-miR-192-5p	Microarray	19074876
MIRT044433	hsa-miR-320a	CLASH	23622248
MIRT573685	hsa-miR-6888-5p	PAR-CLIP	20371350
MIRT573684	hsa-miR-4779	PAR-CLIP	20371350
MIRT573683	hsa-miR-1321	PAR-CLIP	20371350
MIRT573681	hsa-miR-4739	PAR-CLIP	20371350
MIRT573682	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT573680	hsa-miR-7113-5p	PAR-CLIP	20371350
MIRT573679	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT573678	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT573677	hsa-miR-331-3p	PAR-CLIP	20371350
MIRT573676	hsa-miR-4292	PAR-CLIP	20371350
MIRT573674	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT573675	hsa-miR-3192-5p	PAR-CLIP	20371350
MIRT573673	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT573672	hsa-miR-4784	PAR-CLIP	20371350
MIRT573671	hsa-miR-4419a	PAR-CLIP	20371350
MIRT573670	hsa-miR-4510	PAR-CLIP	20371350
MIRT573669	hsa-miR-6127	PAR-CLIP	20371350
MIRT573668	hsa-miR-6129	PAR-CLIP	20371350
MIRT573667	hsa-miR-6130	PAR-CLIP	20371350
MIRT573666	hsa-miR-6133	PAR-CLIP	20371350
MIRT573665	hsa-miR-4683	PAR-CLIP	20371350
MIRT573664	hsa-miR-765	PAR-CLIP	20371350
MIRT573663	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT573662	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT573661	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT573660	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT573659	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT573658	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT573657	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT573655	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT573656	hsa-miR-1273h-5p	PAR-CLIP	20371350
MIRT573654	hsa-miR-30b-3p	PAR-CLIP	20371350
MIRT573653	hsa-miR-3689a-3p	PAR-CLIP	20371350
MIRT573652	hsa-miR-3689b-3p	PAR-CLIP	20371350
MIRT573651	hsa-miR-3689c	PAR-CLIP	20371350
MIRT573650	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT573649	hsa-miR-6780a-5p	PAR-CLIP	20371350
MIRT573685	hsa-miR-6888-5p	PAR-CLIP	20371350
MIRT573684	hsa-miR-4779	PAR-CLIP	20371350
MIRT573683	hsa-miR-1321	PAR-CLIP	20371350
MIRT573681	hsa-miR-4739	PAR-CLIP	20371350
MIRT573682	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT573680	hsa-miR-7113-5p	PAR-CLIP	20371350
MIRT573679	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT573678	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT573677	hsa-miR-331-3p	PAR-CLIP	20371350
MIRT573676	hsa-miR-4292	PAR-CLIP	20371350
MIRT573674	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT573675	hsa-miR-3192-5p	PAR-CLIP	20371350
MIRT573673	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT573672	hsa-miR-4784	PAR-CLIP	20371350
MIRT573671	hsa-miR-4419a	PAR-CLIP	20371350
MIRT573670	hsa-miR-4510	PAR-CLIP	20371350
MIRT573669	hsa-miR-6127	PAR-CLIP	20371350
MIRT573668	hsa-miR-6129	PAR-CLIP	20371350
MIRT573667	hsa-miR-6130	PAR-CLIP	20371350
MIRT573666	hsa-miR-6133	PAR-CLIP	20371350
MIRT573665	hsa-miR-4683	PAR-CLIP	20371350
MIRT573664	hsa-miR-765	PAR-CLIP	20371350
MIRT573663	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT573662	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT573661	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT573660	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT573659	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT573658	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT573657	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT573655	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT573656	hsa-miR-1273h-5p	PAR-CLIP	20371350
MIRT573654	hsa-miR-30b-3p	PAR-CLIP	20371350
MIRT573653	hsa-miR-3689a-3p	PAR-CLIP	20371350
MIRT573652	hsa-miR-3689b-3p	PAR-CLIP	20371350
MIRT573651	hsa-miR-3689c	PAR-CLIP	20371350
MIRT573650	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT573649	hsa-miR-6780a-5p	PAR-CLIP	20371350
MIRT1044666	hsa-miR-146b-3p	CLIP-seq
MIRT1044667	hsa-miR-2276	CLIP-seq
MIRT1044668	hsa-miR-3173-5p	CLIP-seq
MIRT1044669	hsa-miR-4257	CLIP-seq
MIRT1044670	hsa-miR-874	CLIP-seq
MIRT1044669	hsa-miR-4257	CLIP-seq
MIRT1044671	hsa-miR-7	CLIP-seq
MIRT2009739	hsa-miR-378g	CLIP-seq
MIRT2242072	hsa-miR-1285	CLIP-seq
MIRT2242073	hsa-miR-148a	CLIP-seq
MIRT2242074	hsa-miR-148b	CLIP-seq
MIRT2242075	hsa-miR-152	CLIP-seq
MIRT2242076	hsa-miR-3187-5p	CLIP-seq
MIRT2242077	hsa-miR-326	CLIP-seq
MIRT2242078	hsa-miR-330-5p	CLIP-seq
MIRT2242079	hsa-miR-34a	CLIP-seq
MIRT2242080	hsa-miR-34c-5p	CLIP-seq
MIRT2009739	hsa-miR-378g	CLIP-seq
MIRT2242081	hsa-miR-4486	CLIP-seq
MIRT2242082	hsa-miR-449a	CLIP-seq
MIRT2242083	hsa-miR-449b	CLIP-seq
MIRT2242084	hsa-miR-612	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ATOH1	Activation	17826772

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	20211142, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	ISS	10851137
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	10851137
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050767	Process	Regulation of neurogenesis	IBA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
610331	18254	ENSG00000144485

Protein

UniProt ID

Q96HZ4

Protein name

Transcription cofactor HES-6 (C-HAIRY1) (Class B basic helix-loop-helix protein 41) (bHLHb41) (Hairy and enhancer of split 6)

Protein function

Does not bind DNA itself but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. Also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCF3/E47, allowin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	26 → 77	Helix-loop-helix DNA-binding domain	Domain
PF07527	Hairy_orange	95 → 134	Hairy Orange	Domain

Sequence

MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK
LENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDAT
VAAELLNHLLESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDD
LCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRPW

Sequence length

224

Interactions

View interactions

	KEGG
	Human papillomavirus infection

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Irritable Bowel Syndrome	Irritable bowel syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	30015909
Calcinosis Cutis	Associate	33462406
Carcinogenesis	Associate	18160400
Colitis Ulcerative	Associate	33546600
Colorectal Neoplasms	Stimulate	30015909
Coronary Artery Disease	Associate	35934844
Hypoxia	Associate	25734817
Immunoglobulin Light chain Amyloidosis	Associate	32922167
Multiple Myeloma	Associate	32922167
Neoplasm Metastasis	Associate	30015909, 37882055
Neoplasms	Associate	25864518, 30015909, 34198425
Neoplasms	Stimulate	32708551
Osteosarcoma	Associate	37882055
Prostatic Neoplasms	Associate	25864518, 32708551
Uveal melanoma	Associate	33462406, 34198425

HES6 (hes family bHLH transcription factor 6)