Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5550
Gene name Gene Name - the full gene name approved by the HGNC.	Prolyl endopeptidase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PREP
Synonyms (NCBI Gene) Gene synonyms aliases	PE, PEP
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q21
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be invo

Show/Hide all(60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT035971	hsa-miR-1301-3p	CLASH	23622248
MIRT1260883	hsa-miR-1229	CLIP-seq
MIRT1260884	hsa-miR-1264	CLIP-seq
MIRT1260885	hsa-miR-1286	CLIP-seq
MIRT1260886	hsa-miR-136	CLIP-seq
MIRT1260887	hsa-miR-146a	CLIP-seq
MIRT1260888	hsa-miR-146b-5p	CLIP-seq
MIRT1260889	hsa-miR-23a	CLIP-seq
MIRT1260890	hsa-miR-23b	CLIP-seq
MIRT1260891	hsa-miR-23c	CLIP-seq
MIRT1260892	hsa-miR-3143	CLIP-seq
MIRT1260893	hsa-miR-342-3p	CLIP-seq
MIRT1260894	hsa-miR-409-3p	CLIP-seq
MIRT1260895	hsa-miR-4277	CLIP-seq
MIRT1260896	hsa-miR-4291	CLIP-seq
MIRT1260897	hsa-miR-4684-3p	CLIP-seq
MIRT1260898	hsa-miR-4722-5p	CLIP-seq
MIRT1260899	hsa-miR-4729	CLIP-seq
MIRT1260900	hsa-miR-4760-3p	CLIP-seq
MIRT1260901	hsa-miR-4773	CLIP-seq
MIRT1260902	hsa-miR-4795-3p	CLIP-seq
MIRT1260903	hsa-miR-513b	CLIP-seq
MIRT1260904	hsa-miR-515-5p	CLIP-seq
MIRT1260905	hsa-miR-518a-5p	CLIP-seq
MIRT1260906	hsa-miR-527	CLIP-seq
MIRT1260907	hsa-miR-543	CLIP-seq
MIRT1260908	hsa-miR-545	CLIP-seq
MIRT1260909	hsa-miR-589	CLIP-seq
MIRT1260910	hsa-miR-942	CLIP-seq
MIRT2076765	hsa-miR-1246	CLIP-seq
MIRT2076766	hsa-miR-154	CLIP-seq
MIRT2076767	hsa-miR-3976	CLIP-seq
MIRT2303483	hsa-miR-129-3p	CLIP-seq
MIRT1260887	hsa-miR-146a	CLIP-seq
MIRT1260888	hsa-miR-146b-5p	CLIP-seq
MIRT1260895	hsa-miR-4277	CLIP-seq
MIRT1260896	hsa-miR-4291	CLIP-seq
MIRT2303484	hsa-miR-4423-5p	CLIP-seq
MIRT2303485	hsa-miR-4433	CLIP-seq
MIRT2303486	hsa-miR-4459	CLIP-seq
MIRT2303487	hsa-miR-4652-3p	CLIP-seq
MIRT2303488	hsa-miR-4659a-5p	CLIP-seq
MIRT2303489	hsa-miR-4659b-5p	CLIP-seq
MIRT1260900	hsa-miR-4760-3p	CLIP-seq
MIRT2303490	hsa-miR-4768-3p	CLIP-seq
MIRT1260901	hsa-miR-4773	CLIP-seq
MIRT2303491	hsa-miR-4776-3p	CLIP-seq
MIRT2303492	hsa-miR-4780	CLIP-seq
MIRT1260903	hsa-miR-513b	CLIP-seq
MIRT1260908	hsa-miR-545	CLIP-seq
MIRT2303493	hsa-miR-548a-3p	CLIP-seq
MIRT2303494	hsa-miR-548e	CLIP-seq
MIRT2303495	hsa-miR-548f	CLIP-seq
MIRT1260909	hsa-miR-589	CLIP-seq
MIRT2457135	hsa-miR-1299	CLIP-seq
MIRT2457136	hsa-miR-4436b-5p	CLIP-seq
MIRT2457137	hsa-miR-4653-3p	CLIP-seq
MIRT2457138	hsa-miR-4749-3p	CLIP-seq
MIRT2457139	hsa-miR-4782-5p	CLIP-seq
MIRT2457140	hsa-miR-516b	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002003	Process	Angiotensin maturation	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS	9695945
GO:0005515	Function	Protein binding	IPI	23348613
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9695945
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	9695945
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	7959018
GO:0016020	Component	Membrane	HDA	19946888
GO:0016787	Function	Hydrolase activity	IEA
GO:0070012	Function	Oligopeptidase activity	IBA

MIM	HGNC	e!Ensembl
600400	9358	ENSG00000085377

Protein

UniProt ID

P48147

Protein name

Prolyl endopeptidase (PE) (EC 3.4.21.26) (Post-proline cleaving enzyme)

Protein function

Cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long.

PDB

3DDU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02897	Peptidase_S9_N	7 → 423	Prolyl oligopeptidase, N-terminal beta-propeller domain	Domain
PF00326	Peptidase_S9	482 → 707	Prolyl oligopeptidase family	Domain

Sequence

MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIR
GLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILS
DDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTH
DGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAEL
SDDGRYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVF
TFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNI
LQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPR
VFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISI
TPNYSVSRLIFVRHMGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKE
GYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYG
CSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIV
GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP

Sequence length

710

Interactions

View interactions

	KEGG
	Renin-angiotensin system

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (22)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	32491259
Breast Neoplasms	Associate	23555181
Carcinoma Ovarian Epithelial	Associate	22740343
Central Nervous System Infections	Associate	28883518
Colorectal Neoplasms	Associate	24465166
Colorectal Neoplasms	Stimulate	34285715
Fatty Liver	Associate	27760195
Fibrocartilaginous embolism	Associate	35464773
Glucosephosphate Dehydrogenase Deficiency	Associate	23555181
Intervertebral Disc Degeneration	Associate	35464773
Intestinal Pseudo Obstruction	Associate	30961553
Leukemia Lymphocytic Chronic B Cell	Associate	20534982
Macular Degeneration	Associate	34891119
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Associate	32491259
Neoplasm Metastasis	Associate	22740343, 24465166
Neoplasms	Associate	19035315, 23555181, 30961553
Neoplasms	Stimulate	22740343
Neurodegenerative Diseases	Associate	16086671, 16092940
Neurologic Manifestations	Associate	32491259
Ovarian Neoplasms	Associate	22740343
Ovarian Neoplasms	Inhibit	39972314
Thyroid Cancer Papillary	Associate	19035315

PREP (prolyl endopeptidase)