Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5546
Gene name Gene Name - the full gene name approved by the HGNC.
Proline rich mitotic checkpoint control factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRCC
Synonyms (NCBI Gene) Gene synonyms aliases
RCCP1, TPRC
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that may play a role in pre-mRNA splicing. Chromosomal translocations (X;1)(p11;q21) that result in fusion of this gene to TFE3 (GeneID 7030) have been associated with papillary renal cell carcinoma. A PRCC-TFE3 fusion protein
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT040762 hsa-miR-18a-3p CLASH 23622248
MIRT039451 hsa-miR-421 CLASH 23622248
MIRT037286 hsa-miR-877-5p CLASH 23622248
MIRT1259775 hsa-miR-1224-3p CLIP-seq
MIRT1259776 hsa-miR-1225-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11717438, 26871637
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 11717438
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
179755 9343 ENSG00000143294
Protein
UniProt ID Q92733
Protein name Proline-rich protein PRCC (Papillary renal cell carcinoma translocation-associated gene protein)
Protein function May regulate cell cycle progression through interaction with MAD2L2.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10253 PRCC 275 491 Mitotic checkpoint regulator, MAD2B-interacting Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous in fetal and adult tissues.
Sequence
MSLVAYASSDESEPDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAP
AFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPSPRGPGL
NLPPPIGGAGPPLGLPKPKKRKEPVKIAAPELHKGDSDSEEDEPTKKKTILQGSSEGTGL
SALLPQPKNLTVKETNRLLLPHAFSRKPSDGSPDTKPSRLASKTKTSSLAPVVGTTTTTP
SPSAIKAAAKSAALQVTKQITQEEDDSDEEVAPENFFSLPEKAEPPGVEPYPYPIPTVPE
ELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTYGDANAAGAYY
QDYYSGGYYPAQDPALVPPQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS
GAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKL
SRRQTQAKYGF
Sequence length 491
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Transcriptional misregulation in cancer
Renal cell carcinoma
  mRNA Splicing - Major Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Sjogren-Larsson Syndrome Sjogren-Larsson Syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Calcinosis Associate 29713041
Carcinogenesis Associate 35396773
Carcinoma Renal Cell Associate 28949976, 33019842, 35118587, 35396773, 40061565
Deafness X Linked 1 Associate 21602817
Lymphatic Metastasis Associate 31348270
Mitochondrial Diseases Associate 33019842
Neoplasms Associate 21602817, 33019842, 35396773
Thyroid Cancer Papillary Associate 29713041