Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55435
Gene name	Adaptor related protein complex 1 associated regulatory protein
Gene symbol	AP1AR
Synonyms (NCBI Gene)	2C18C4orf16GBARPRO0971gamma-BAR
Chromosome	4
Chromosome location	4q25

186

Show/Hide all (186)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048859	hsa-miR-93-5p	CLASH	23622248
MIRT559581	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT559579	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT559580	hsa-miR-141-5p	HITS-CLIP	21572407
MIRT559578	hsa-miR-302a-5p	HITS-CLIP	21572407
MIRT559576	hsa-miR-4778-3p	HITS-CLIP	21572407
MIRT559577	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT559581	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT559579	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT559580	hsa-miR-141-5p	PAR-CLIP	21572407
MIRT559578	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT559576	hsa-miR-4778-3p	PAR-CLIP	21572407
MIRT559577	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT441046	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT441046	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT559581	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT559579	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT559580	hsa-miR-141-5p	HITS-CLIP	21572407
MIRT559578	hsa-miR-302a-5p	HITS-CLIP	21572407
MIRT559576	hsa-miR-4778-3p	HITS-CLIP	21572407
MIRT559577	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT559581	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT559579	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT559580	hsa-miR-141-5p	PAR-CLIP	21572407
MIRT559578	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT559576	hsa-miR-4778-3p	PAR-CLIP	21572407
MIRT559577	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT786749	hsa-miR-3125	CLIP-seq
MIRT786750	hsa-miR-3126-3p	CLIP-seq
MIRT786751	hsa-miR-3148	CLIP-seq
MIRT786752	hsa-miR-337-3p	CLIP-seq
MIRT786753	hsa-miR-34b	CLIP-seq
MIRT786754	hsa-miR-3667-3p	CLIP-seq
MIRT786755	hsa-miR-377	CLIP-seq
MIRT786756	hsa-miR-378	CLIP-seq
MIRT786757	hsa-miR-378b	CLIP-seq
MIRT786758	hsa-miR-378c	CLIP-seq
MIRT786759	hsa-miR-378d	CLIP-seq
MIRT786760	hsa-miR-378e	CLIP-seq
MIRT786761	hsa-miR-378f	CLIP-seq
MIRT786762	hsa-miR-378h	CLIP-seq
MIRT786763	hsa-miR-378i	CLIP-seq
MIRT786764	hsa-miR-3916	CLIP-seq
MIRT786765	hsa-miR-3974	CLIP-seq
MIRT786766	hsa-miR-422a	CLIP-seq
MIRT786767	hsa-miR-4289	CLIP-seq
MIRT786768	hsa-miR-4511	CLIP-seq
MIRT786769	hsa-miR-4535	CLIP-seq
MIRT786770	hsa-miR-4638-3p	CLIP-seq
MIRT786771	hsa-miR-4684-3p	CLIP-seq
MIRT786772	hsa-miR-4696	CLIP-seq
MIRT786773	hsa-miR-4705	CLIP-seq
MIRT786774	hsa-miR-4789-5p	CLIP-seq
MIRT786775	hsa-miR-492	CLIP-seq
MIRT786776	hsa-miR-501-3p	CLIP-seq
MIRT786777	hsa-miR-502-3p	CLIP-seq
MIRT786778	hsa-miR-548b-3p	CLIP-seq
MIRT786779	hsa-miR-590-3p	CLIP-seq
MIRT786780	hsa-miR-616	CLIP-seq
MIRT786781	hsa-miR-624	CLIP-seq
MIRT786768	hsa-miR-4511	CLIP-seq
MIRT1932050	hsa-miR-155	CLIP-seq
MIRT1932051	hsa-miR-3942-3p	CLIP-seq
MIRT786768	hsa-miR-4511	CLIP-seq
MIRT786780	hsa-miR-616	CLIP-seq
MIRT2172470	hsa-miR-1245b-3p	CLIP-seq
MIRT2172471	hsa-miR-133a	CLIP-seq
MIRT2172472	hsa-miR-133b	CLIP-seq
MIRT2172473	hsa-miR-1470	CLIP-seq
MIRT2172474	hsa-miR-181a	CLIP-seq
MIRT2172475	hsa-miR-181b	CLIP-seq
MIRT2172476	hsa-miR-181c	CLIP-seq
MIRT2172477	hsa-miR-181d	CLIP-seq
MIRT2172478	hsa-miR-205	CLIP-seq
MIRT2172479	hsa-miR-2115	CLIP-seq
MIRT2172480	hsa-miR-23a	CLIP-seq
MIRT2172481	hsa-miR-23b	CLIP-seq
MIRT2172482	hsa-miR-23c	CLIP-seq
MIRT2172483	hsa-miR-298	CLIP-seq
MIRT2172484	hsa-miR-3074-3p	CLIP-seq
MIRT2172485	hsa-miR-3143	CLIP-seq
MIRT2172486	hsa-miR-3613-3p	CLIP-seq
MIRT2172487	hsa-miR-3619-3p	CLIP-seq
MIRT2172488	hsa-miR-3622b-5p	CLIP-seq
MIRT2172489	hsa-miR-3677-5p	CLIP-seq
MIRT2172490	hsa-miR-3714	CLIP-seq
MIRT2172491	hsa-miR-4259	CLIP-seq
MIRT2172492	hsa-miR-4262	CLIP-seq
MIRT2172493	hsa-miR-4275	CLIP-seq
MIRT2172494	hsa-miR-4310	CLIP-seq
MIRT2172495	hsa-miR-4427	CLIP-seq
MIRT2172496	hsa-miR-4635	CLIP-seq
MIRT2172497	hsa-miR-4667-3p	CLIP-seq
MIRT2172498	hsa-miR-4680-3p	CLIP-seq
MIRT2172499	hsa-miR-4700-3p	CLIP-seq
MIRT2172500	hsa-miR-4715-5p	CLIP-seq
MIRT786774	hsa-miR-4789-5p	CLIP-seq
MIRT2172501	hsa-miR-4799-5p	CLIP-seq
MIRT2172502	hsa-miR-516a-3p	CLIP-seq
MIRT2172503	hsa-miR-543	CLIP-seq
MIRT2464854	hsa-miR-208a	CLIP-seq
MIRT2464855	hsa-miR-208b	CLIP-seq
MIRT2464856	hsa-miR-3617	CLIP-seq
MIRT2464857	hsa-miR-499-5p	CLIP-seq
MIRT2464858	hsa-miR-641	CLIP-seq
MIRT2172470	hsa-miR-1245b-3p	CLIP-seq
MIRT2475441	hsa-miR-1272	CLIP-seq
MIRT2172474	hsa-miR-181a	CLIP-seq
MIRT2172475	hsa-miR-181b	CLIP-seq
MIRT2172476	hsa-miR-181c	CLIP-seq
MIRT2172477	hsa-miR-181d	CLIP-seq
MIRT2475442	hsa-miR-2054	CLIP-seq
MIRT2475443	hsa-miR-25	CLIP-seq
MIRT2172483	hsa-miR-298	CLIP-seq
MIRT2475444	hsa-miR-3121-5p	CLIP-seq
MIRT2172485	hsa-miR-3143	CLIP-seq
MIRT2475445	hsa-miR-3162-3p	CLIP-seq
MIRT2475446	hsa-miR-32	CLIP-seq
MIRT786753	hsa-miR-34b	CLIP-seq
MIRT2172487	hsa-miR-3619-3p	CLIP-seq
MIRT2475447	hsa-miR-363	CLIP-seq
MIRT2475448	hsa-miR-367	CLIP-seq
MIRT2475449	hsa-miR-3686	CLIP-seq
MIRT2172490	hsa-miR-3714	CLIP-seq
MIRT2475450	hsa-miR-3941	CLIP-seq
MIRT1932051	hsa-miR-3942-3p	CLIP-seq
MIRT2172491	hsa-miR-4259	CLIP-seq
MIRT2172492	hsa-miR-4262	CLIP-seq
MIRT2475451	hsa-miR-4287	CLIP-seq
MIRT2475452	hsa-miR-4325	CLIP-seq
MIRT2475453	hsa-miR-4469	CLIP-seq
MIRT2172496	hsa-miR-4635	CLIP-seq
MIRT2475454	hsa-miR-4643	CLIP-seq
MIRT2475455	hsa-miR-466	CLIP-seq
MIRT2475456	hsa-miR-4672	CLIP-seq
MIRT2475457	hsa-miR-4685-3p	CLIP-seq
MIRT2172499	hsa-miR-4700-3p	CLIP-seq
MIRT786773	hsa-miR-4705	CLIP-seq
MIRT2172500	hsa-miR-4715-5p	CLIP-seq
MIRT2475458	hsa-miR-4742-3p	CLIP-seq
MIRT2475459	hsa-miR-4778-5p	CLIP-seq
MIRT2475460	hsa-miR-4789-3p	CLIP-seq
MIRT786774	hsa-miR-4789-5p	CLIP-seq
MIRT2475461	hsa-miR-520d-5p	CLIP-seq
MIRT2475462	hsa-miR-524-5p	CLIP-seq
MIRT2172503	hsa-miR-543	CLIP-seq
MIRT2475463	hsa-miR-92a	CLIP-seq
MIRT2475464	hsa-miR-92b	CLIP-seq
MIRT2172470	hsa-miR-1245b-3p	CLIP-seq
MIRT2475441	hsa-miR-1272	CLIP-seq
MIRT2172474	hsa-miR-181a	CLIP-seq
MIRT2172475	hsa-miR-181b	CLIP-seq
MIRT2172476	hsa-miR-181c	CLIP-seq
MIRT2172477	hsa-miR-181d	CLIP-seq
MIRT2475443	hsa-miR-25	CLIP-seq
MIRT2172483	hsa-miR-298	CLIP-seq
MIRT2475446	hsa-miR-32	CLIP-seq
MIRT786753	hsa-miR-34b	CLIP-seq
MIRT2172487	hsa-miR-3619-3p	CLIP-seq
MIRT2475447	hsa-miR-363	CLIP-seq
MIRT2475448	hsa-miR-367	CLIP-seq
MIRT2475449	hsa-miR-3686	CLIP-seq
MIRT2172490	hsa-miR-3714	CLIP-seq
MIRT2475450	hsa-miR-3941	CLIP-seq
MIRT1932051	hsa-miR-3942-3p	CLIP-seq
MIRT2172491	hsa-miR-4259	CLIP-seq
MIRT2172492	hsa-miR-4262	CLIP-seq
MIRT2475451	hsa-miR-4287	CLIP-seq
MIRT2475452	hsa-miR-4325	CLIP-seq
MIRT2475453	hsa-miR-4469	CLIP-seq
MIRT2172496	hsa-miR-4635	CLIP-seq
MIRT2475454	hsa-miR-4643	CLIP-seq
MIRT2475455	hsa-miR-466	CLIP-seq
MIRT2475456	hsa-miR-4672	CLIP-seq
MIRT2475457	hsa-miR-4685-3p	CLIP-seq
MIRT2172499	hsa-miR-4700-3p	CLIP-seq
MIRT786773	hsa-miR-4705	CLIP-seq
MIRT2172500	hsa-miR-4715-5p	CLIP-seq
MIRT2475458	hsa-miR-4742-3p	CLIP-seq
MIRT2475459	hsa-miR-4778-5p	CLIP-seq
MIRT2475460	hsa-miR-4789-3p	CLIP-seq
MIRT786774	hsa-miR-4789-5p	CLIP-seq
MIRT2475461	hsa-miR-520d-5p	CLIP-seq
MIRT2475462	hsa-miR-524-5p	CLIP-seq
MIRT2475463	hsa-miR-92a	CLIP-seq
MIRT2475464	hsa-miR-92b	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001920	Process	Negative regulation of receptor recycling	IMP	19706427
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0015031	Process	Protein transport	IEA
GO:0019894	Function	Kinesin binding	IBA
GO:0019894	Function	Kinesin binding	IDA	19706427
GO:0030133	Component	Transport vesicle	IDA
GO:0034315	Process	Regulation of Arp2/3 complex-mediated actin nucleation	IEA
GO:0034315	Process	Regulation of Arp2/3 complex-mediated actin nucleation	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0035650	Function	AP-1 adaptor complex binding	IBA
GO:0035650	Function	AP-1 adaptor complex binding	IDA	19706427
GO:0035650	Function	AP-1 adaptor complex binding	IEA
GO:0048203	Process	Vesicle targeting, trans-Golgi to endosome	IBA
GO:0048203	Process	Vesicle targeting, trans-Golgi to endosome	IDA	19706427
GO:0048203	Process	Vesicle targeting, trans-Golgi to endosome	IEA
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IEA
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IEA
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IMP	22689987
GO:2000146	Process	Negative regulation of cell motility	IEA
GO:2000146	Process	Negative regulation of cell motility	IEA

MIM	HGNC	e!Ensembl
610851	28808	ENSG00000138660

Q63HQ0

Protein name

AP-1 complex-associated regulatory protein (2c18) (Adaptor-related protein complex 1-associated regulatory protein) (Gamma-1-adaptin brefeldin A resistance protein) (GBAR) (Gamma-BAR) (Gamma-A1-adaptin and kinesin interactor) (Gadkin)

Protein function

Necessary for adaptor protein complex 1 (AP-1)-dependent transport between the trans-Golgi network and endosomes. Regulates the membrane association of AP1G1/gamma1-adaptin, one of the subunits of the AP-1 adaptor complex. The direct interaction

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15745	AP1AR	26 → 302	AP-1 complex-associated regulatory protein	Family

Sequence

MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSS
HRPLTEEEIVDLRERHYDSIAEKQKDLDKKIQKELALQEEKLRLEEEALYAAQREAARAA
KQRKLLEQERQRIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVL
TPNTESSCDLMTKTKSTSGNDDSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYS
NKKTGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGFVNPVLELSDSGIRHSDTDQQ
TR

Sequence length

302

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Inflammation	Associate	17576808	★★★★★ ★☆☆☆☆ Found in Text Mining only

AP1AR (adaptor related protein complex 1 associated regulatory protein)