LINC00862 (long intergenic non-protein coding RNA 862)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
554279
Gene name Gene Name - the full gene name approved by the HGNC.
Long intergenic non-protein coding RNA 862
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LINC00862
Synonyms (NCBI Gene) Gene synonyms aliases
C1orf98, SMIM16
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT018116 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID A6NCI5
Protein name Putative transmembrane protein encoded by LINC00862 (Small integral membrane protein 16)
Family and domains
Sequence 
MVCYLYWETFPSISHLLKITLSARDCHVCGLNLFIFMDPVENQALHPVIMALILMPSLHC
FGNILILLFLKSPAQLFCRMSVDLALLFPHK
Sequence length 91
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (7)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast cancer Invasive breast cancer N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Gout Gout N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Epilepsy Associate 27878761
Olfaction Disorders Associate 27878761
Pediatric acute onset neuropsychiatric syndrome Associate 27878761
Schizophrenia Associate 27878761