Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55423
Gene name Gene Name - the full gene name approved by the HGNC.	Signal regulatory protein gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SIRPG
Synonyms (NCBI Gene) Gene synonyms aliases	CD172g, SIRP-B2, SIRPB2, SIRPgamma, bA77C3.1
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20p13
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulat

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT454686	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT454685	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT454684	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT454683	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT454681	hsa-miR-4736	PAR-CLIP	23592263
MIRT454682	hsa-miR-7150	PAR-CLIP	23592263
MIRT454686	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT454685	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT454684	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT454683	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT454681	hsa-miR-4736	PAR-CLIP	23592263
MIRT454682	hsa-miR-7150	PAR-CLIP	23592263
MIRT1350041	hsa-miR-548aa	CLIP-seq
MIRT2327868	hsa-miR-1252	CLIP-seq
MIRT2327869	hsa-miR-2682	CLIP-seq
MIRT2327870	hsa-miR-4476	CLIP-seq
MIRT2327871	hsa-miR-449c	CLIP-seq
MIRT2327872	hsa-miR-4533	CLIP-seq
MIRT2327873	hsa-miR-940	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15383453, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007267	Process	Cell-cell signaling	TAS	9062191
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15383453
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9062191
GO:0016020	Component	Membrane	IDA	15383453
GO:0016020	Component	Membrane	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IDA	15383453
GO:0035556	Process	Intracellular signal transduction	TAS	9062191
GO:0050766	Process	Positive regulation of phagocytosis	IBA
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0050870	Process	Positive regulation of T cell activation	IDA	15383453

MIM	HGNC	e!Ensembl
605466	15757	ENSG00000089012

Protein

UniProt ID

Q9P1W8

Protein name

Signal-regulatory protein gamma (SIRP-gamma) (CD172 antigen-like family member B) (Signal-regulatory protein beta-2) (SIRP-b2) (SIRP-beta-2) (CD antigen CD172g)

Protein function

Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell ac

PDB

2JJW , 4I2X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	36 → 139	Immunoglobulin V-set domain	Domain
PF07654	C1-set	150 → 233	Immunoglobulin C1-set domain	Domain
PF07654	C1-set	253 → 336	Immunoglobulin C1-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in liver, and at very low levels in brain, heart, lung, pancreas, kidney, placenta and skeletal muscle. Expressed on CD4+ T-cells, CD8+ T-cells, CD56-bright natural killer (NK) cells, CD20+ cells, and all activated NK cells. M

Sequence

MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLP
VGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCV
KFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITL
KWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRG
TANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQLTWSENGNVCQRETASTL
TENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRLALEVTVHQKDQSSDATP
GPASSLTALLLIAVLLGPIYVPWKQKT

Sequence length

387

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Osteoclast differentiation		Cell surface interactions at the vascular wall Signal regulatory protein family interactions

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 1 diabetes	N/A	N/A	GWAS
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Intracranial Aneurysm	Intracranial aneurysm	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Stimulate	35229723
Autoimmune Diseases	Associate	30337675, 30579937
Azoospermia	Associate	24303009
Azoospermia Nonobstructive	Associate	30863997
Cardiovascular Diseases	Associate	39533565
Diabetes Mellitus Type 1	Associate	21270831, 30337675, 30579937, 34799406, 39533565
Diabetic Retinopathy	Associate	38274229
Endometrial Neoplasms	Associate	36096644
Infertility Male	Associate	30863997
Lichen Planus	Associate	39533565
Lipid Metabolism Disorders	Associate	39533565
Lung Neoplasms	Associate	35229723
Melanoma	Associate	35909944
Metabolic Syndrome	Associate	39533565
Narcolepsy	Associate	37188663
Neoplasm Metastasis	Associate	35229723
Neoplasms	Associate	35229723
Neuralgia	Associate	39533565
Oligospermia	Associate	24303009
Squamous Cell Carcinoma of Head and Neck	Associate	34091115

SIRPG (signal regulatory protein gamma)