Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55423
Gene name	Signal regulatory protein gamma
Gene symbol	SIRPG
Synonyms (NCBI Gene)	CD172gSIRP-B2SIRPB2SIRPgammabA77C3.1
Chromosome	20
Chromosome location	20p13
Summary	The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulat

Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT454686	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT454685	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT454684	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT454683	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT454681	hsa-miR-4736	PAR-CLIP	23592263
MIRT454682	hsa-miR-7150	PAR-CLIP	23592263
MIRT454686	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT454685	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT454684	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT454683	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT454681	hsa-miR-4736	PAR-CLIP	23592263
MIRT454682	hsa-miR-7150	PAR-CLIP	23592263
MIRT1350041	hsa-miR-548aa	CLIP-seq
MIRT2327868	hsa-miR-1252	CLIP-seq
MIRT2327869	hsa-miR-2682	CLIP-seq
MIRT2327870	hsa-miR-4476	CLIP-seq
MIRT2327871	hsa-miR-449c	CLIP-seq
MIRT2327872	hsa-miR-4533	CLIP-seq
MIRT2327873	hsa-miR-940	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15383453, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007267	Process	Cell-cell signaling	TAS	9062191
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15383453
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9062191
GO:0016020	Component	Membrane	IDA	15383453
GO:0016020	Component	Membrane	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IDA	15383453
GO:0035556	Process	Intracellular signal transduction	TAS	9062191
GO:0050766	Process	Positive regulation of phagocytosis	IBA
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0050870	Process	Positive regulation of T cell activation	IDA	15383453

MIM	HGNC	e!Ensembl
605466	15757	ENSG00000089012

Q9P1W8

Protein name

Signal-regulatory protein gamma (SIRP-gamma) (CD172 antigen-like family member B) (Signal-regulatory protein beta-2) (SIRP-b2) (SIRP-beta-2) (CD antigen CD172g)

Protein function

Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell ac

PDB

2JJW , 4I2X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	36 → 139	Immunoglobulin V-set domain	Domain
PF07654	C1-set	150 → 233	Immunoglobulin C1-set domain	Domain
PF07654	C1-set	253 → 336	Immunoglobulin C1-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in liver, and at very low levels in brain, heart, lung, pancreas, kidney, placenta and skeletal muscle. Expressed on CD4+ T-cells, CD8+ T-cells, CD56-bright natural killer (NK) cells, CD20+ cells, and all activated NK cells. M

Sequence

MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLP
VGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCV
KFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITL
KWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRG
TANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQLTWSENGNVCQRETASTL
TENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRLALEVTVHQKDQSSDATP
GPASSLTALLLIAVLLGPIYVPWKQKT

Sequence length

387

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Osteoclast differentiation		Cell surface interactions at the vascular wall Signal regulatory protein family interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRAIN ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY WITH AZOOSPERMIA OR OLIGOZOOSPERMIA DUE TO SINGLE GENE MUTATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Stimulate	35229723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Associate	30337675, 30579937	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Associate	24303009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia Nonobstructive	Associate	30863997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	39533565	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	21270831, 30337675, 30579937, 34799406, 39533565	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Associate	38274229	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	36096644	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Associate	30863997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lichen Planus	Associate	39533565	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Associate	39533565	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	35229723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	35909944	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Associate	39533565	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Associate	37188663	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	35229723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	35229723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuralgia	Associate	39533565	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Associate	24303009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	34091115	★★★★★ ★☆☆☆☆ Found in Text Mining only

SIRPG (signal regulatory protein gamma)