SIRPG (signal regulatory protein gamma)

Gene

• Entrez ID: 55423
• Gene name: Signal regulatory protein gamma
• Gene symbol: SIRPG
• Synonyms (NCBI Gene): CD172g, SIRP-B2, SIRPB2, SIRPgamma, bA77C3.1
• Chromosome: 20
• Chromosome location: 20p13
• Summary: The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT454686	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT454685	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT454684	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT454683	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT454681	hsa-miR-4736	PAR-CLIP	23592263
MIRT454682	hsa-miR-7150	PAR-CLIP	23592263
MIRT454686	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT454685	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT454684	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT454683	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT454681	hsa-miR-4736	PAR-CLIP	23592263
MIRT454682	hsa-miR-7150	PAR-CLIP	23592263
MIRT1350041	hsa-miR-548aa	CLIP-seq
MIRT2327868	hsa-miR-1252	CLIP-seq
MIRT2327869	hsa-miR-2682	CLIP-seq
MIRT2327870	hsa-miR-4476	CLIP-seq
MIRT2327871	hsa-miR-449c	CLIP-seq
MIRT2327872	hsa-miR-4533	CLIP-seq
MIRT2327873	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15383453, 32814053
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007267	Process	Cell-cell signaling	TAS	9062191
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15383453
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9062191
GO:0016020	Component	Membrane	IDA	15383453
GO:0016021	Component	Integral component of membrane	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IDA	15383453
GO:0035556	Process	Intracellular signal transduction	TAS	9062191
GO:0050766	Process	Positive regulation of phagocytosis	IBA	21873635
GO:0050870	Process	Positive regulation of T cell activation	IBA	21873635
GO:0050870	Process	Positive regulation of T cell activation	IDA	15383453
GO:0050900	Process	Leukocyte migration	TAS

Other IDs

• MIM: 605466
• HGNC: 15757
• e!Ensembl: ENSG00000089012

Protein

• UniProt ID: Q9P1W8
• Protein name: Signal-regulatory protein gamma (SIRP-gamma) (CD172 antigen-like family member B) (Signal-regulatory protein beta-2) (SIRP-b2) (SIRP-beta-2) (CD antigen CD172g)
• Protein function: Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell ac
• PDB: 2JJW, 4I2X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	36 → 139	Immunoglobulin V-set domain	Domain
  PF07654	C1-set	150 → 233	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	253 → 336	Immunoglobulin C1-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in liver, and at very low levels in brain, heart, lung, pancreas, kidney, placenta and skeletal muscle. Expressed on CD4+ T-cells, CD8+ T-cells, CD56-bright natural killer (NK) cells, CD20+ cells, and all activated NK cells. M
• Sequence:

  MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLP
  VGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCV
  KFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITL
  KWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRG
  TANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQLTWSENGNVCQRETASTL
  TENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRLALEVTVHQKDQSSDATP
  GPASSLTALLLIAVLLGPIYVPWKQKT

• Sequence length: 387

Pathways

KEGG:

Efferocytosis
Osteoclast differentiation

Reactome:

Cell surface interactions at the vascular wall
Signal regulatory protein family interactions

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	19430480, 25751624
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	22190364

Unknown
Disease term	Disease name	Evidence	References	Source
Diabetes	Diabetes			GWAS
Intracranial Aneurysm	Intracranial Aneurysm			GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA
Schizophrenia	Schizophrenia			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma of Lung	Stimulate	35229723
Autoimmune Diseases	Associate	30337675, 30579937
Azoospermia	Associate	24303009
Azoospermia Nonobstructive	Associate	30863997
Cardiovascular Diseases	Associate	39533565
Diabetes Mellitus Type 1	Associate	21270831, 30337675, 30579937, 34799406, 39533565
Diabetic Retinopathy	Associate	38274229
Endometrial Neoplasms	Associate	36096644
Infertility Male	Associate	30863997
Lichen Planus	Associate	39533565
Lipid Metabolism Disorders	Associate	39533565
Lung Neoplasms	Associate	35229723
Melanoma	Associate	35909944
Metabolic Syndrome	Associate	39533565
Narcolepsy	Associate	37188663
Neoplasm Metastasis	Associate	35229723
Neoplasms	Associate	35229723
Neuralgia	Associate	39533565
Oligospermia	Associate	24303009
Squamous Cell Carcinoma of Head and Neck	Associate	34091115